prompt
stringlengths 48
10.5k
| response
stringlengths 0
1.56k
|
---|---|
Generate a 5-star review (1 being lowest and 5 being highest) about an app with package net.sourceforge.opencamera.
The answer to this question is: | Fantastic |
Q: In this task you are given a list of numbers and you need to find the average of each two consecutive values. The average of two numbers a and b is calculated as: (a + b) /2. The output should be a list of the averages of each two consecutive values. A list is presented with two brackets and comma-separated values, like: [1,2,3].
[97, -36, 34, -41, -5, 39, 82, 81]
A: | [30.5, -1.0, -3.5, -23.0, 17.0, 60.5, 81.5] |
Given an adjective, generate its antonym. An antonym of a word is a word opposite in meaning to it.
[Q]: impermeable
[A]: permeable
[Q]: unquotable
[A]: quotable
[Q]: noncompetitive
[A]: | competitive
|
Given a concept word, generate a hypernym for it. A hypernym is a superordinate, i.e. a word with a broad meaning constituting a category, that generalizes another word. For example, color is a hypernym of red.
Example: crystal
Example solution: rock
Example explanation: A crystal is a type of rock, so rock is a valid hypernym output.
Problem: glider
| Solution: artifact |
Instructions: In this task, you will be shown an English sentence. You need to classify the sentence as either a representation of an anaphor number agreement or as an incorrect representation. An anaphor is an expression whose interpretation depends upon another expression. Anaphor number agreement is a restriction where a phrase agrees with the preceeding expression: plurals match plurals or singular expressions match singular expressions. In this task a valid representation of anaphor number agreement should be denoted as 'good' while everything else should be denoted as 'bad'. A correct representation of an anaphor number agreement will be a grammatically correct instance of a sentence where the subject and self-referencing nouns match plurality. An incorrect representation is a sentence in which the subject and self-referencing noun's plurality do not match.
Input: Homer can find himself.
Output: | good |
The input contains texts obtained from news articles, ted talks, movie transcripts, radio transcripts, science and technology texts, and other short articles curated from the web and professional translators. Your task is to translate the given Yoruba sentence into the English language. Please bear in mind the following guidelines while doing the translation: 1) Generated output should be natural language and formal form of each sentence in your language. The output sentence should not be a colloquial form of the input sentence. The generated output should be in natural language which is how you would type your queries in a text-based virtual assistant. 2) The words between quotation marks *SHOULD NOT* be translated. We expect you to keep those values intact and include the quotation marks around them as well. 3) Numbers and fully capitalized words like SEPTEMBER, or 10 HOURS *SHOULD NOT* be translated. Please keep them as they are in the translations. 4) Please do not localize measurement units like miles to kilometers during your translation. 5) Note the input is in sentence case except for special placeholders. Please do the same in your translations.
[Q]: O kò ní àwọn olùkọ́ èyíkèyí tí a yàn
[A]: You don't have any assigned coaches
[Q]: Ni parí, mo lérò wípé èyí yóò ṣiṣẹ́ fún ìdá ọgọ́rin ọkùnrin pẹ̀lú àdúrà, sùúrù àti àmójúkúrò.
[A]: In conclusion, I hope that this will work for over 40 percent of men with prayers, patience and overlooking things.
[Q]: Ẹ̀yin lẹ rà á?
[A]: | You bought it?
|
Part 1. Definition
Read the given story and classify it as 'imagined', 'recalled', or 'retold'. If a story is imagined, the person who wrote the story is making it up, pretending they experienced it. If a story is recalled, the person who wrote the story really experienced it and is recalling it from memory. If a story is retold, it is a real memory like the 'recalled' stories, but written down much later after previously writing a 'recalled' story about the same events. So, recalled stories and retold stories will be fairly similar, in that they both were real experiences for the writer. Imagined stories have a more linear flow and contain more commonsense knowledge, whereas recalled stories are less connected and contain more specific concrete events. Additionally, higher levels of self reference are found in imagined stories. Between recalled and retold stories, retold stories flow significantly more linearly than recalled stories, and retold stories are significantly higher in scores for cognitive processes and positive tone.
Part 2. Example
Concerts are my most favorite thing, and my boyfriend knew it. That's why, for our anniversary, he got me tickets to see my favorite artist. Not only that, but the tickets were for an outdoor show, which I love much more than being in a crowded stadium. Since he knew I was such a big fan of music, he got tickets for himself, and even a couple of my friends. He is so incredibly nice and considerate to me and what I like to do. I will always remember this event and I will always cherish him. On the day of the concert, I got ready, and he picked me up and we went out to a restaurant beforehand. He is so incredibly romantic. He knew exactly where to take me without asking. We ate, laughed, and had a wonderful dinner date before the big event. We arrived at the concert and the music was so incredibly beautiful. I loved every minute of it. My friends, boyfriend, and I all sat down next to each other. As the music was slowly dying down, I found us all getting lost just staring at the stars. It was such an incredibly unforgettable and beautiful night.
Answer: imagined
Explanation: This is a good example because it really was an imagined story. The attributes that should tip you off are that the story is light on concrete events (they describe things in broad terms such as going to a restaurant and being at the stadium, but nothing specific about who was exactly where and anything specifically notable someone said or did) and heavy on references to the writer themselves and their internal feelings (they frequently repeat how much they loved it, how romantic they felt, how they cherished the night, etc). It's also very linear and structured, pointing to this being an imagined story. Additionally, the events and feelings described seem a little romanticized or idealized beyond what is usually a realistic circumstance.
Part 3. Exercise
About 3 months ago my wife and I looked at a house that came on the market. This home had 4 acres and a 6 car garage which we fell in love with. After a visit to a bank for a pre approval we have decided to list our home as for sale by owner on zillow make me move to make the offer seem better contingent on sale of our home. The evening of us making an offer on the house we liked they have accepted an offer overbidding the asking price. Being that our home was still on the market on zillow I had a realtor reach out to me to show the house to his client. A few days later a lady came with her realtor and spent about an hour touring the home. By the end of the tour she deicded to buy the house for full asking price for a cash deal. I was really surprised and thrown off by this especially since there was no other lined up home for us to purchase. I could not say no to an offer that was presented even with circumstances of us not having anywhere to go at the moment. Because the deal was a cash sale there was not much but a home inpection and closing date was chosen 3 weeks from signing the sale agreement. In the span of 3 weeks we found a rental with only a week left to closing. In a manner of 1 day we moved the entire home into a very nice rental while we shop for a new home. The whole course of the three weeks before closing were extremely stressful and chaotic in midst of trying to find a rental that quickly and hoping things would not fall through with inspection or the sale after signing a lease and moving all our belongings. Overall it was a very unique experience and I could not be happier. We are still searching for the right house btw.
Answer: | retold |
Q: In this task you will be given a string of characters. You should remove all vowels from the given string. Vowels are: i,e,a,u,o. The character 'y' or 'Y' does not count as a vowel.
inASXwkBBuaOi
A: | nSXwkBB |
Detailed Instructions: In this task you will be given a string of characters. You should remove all vowels from the given string. Vowels are: i,e,a,u,o. The character 'y' or 'Y' does not count as a vowel.
Problem:JGGJ
Solution: | JGGJ |
Detailed Instructions: Find the movie name from the given conversation. If the movie name is not found give output as "unknown"
Q: ASSISTANT: hello , USER: Hello. , ASSISTANT: What kind of movies do you like? , USER: Dramas, mostly. , ASSISTANT: Why do you like those kinds of movies? , USER: If they are written well then the story and the character are usually engaging and I find it to be a good exploration of the human condition. , ASSISTANT: Can you name a particular movie you like? , USER: Yeah, Her.
A: | Her |
In this task, you are given a country name and you need to answer with the government type of the country, as of the year 2015. The following are possible government types that are considered valid answers: Republic, Parliamentary Coprincipality, Federal Republic, Monarchy, Islamic Republic, Constitutional Monarchy, Parlementary Monarchy, Federation.
Laos
Republic
Greece
Republic
Gibraltar
| Dependent Territory of the UK
|
In this task, you are given two strings A,B. You must perform the following operations to generate the required output list: (i) Find the longest common substring in the strings A and B, (ii) Convert this substring to all lowercase and sort it alphabetically, (iii) Replace the substring at its respective positions in the two lists with the updated substring.
--------
Question: NCcOzQETvLSMiEbPouxUMjh, zxjOETvLSMiEbCzMDE
Answer: NCcOzQbeeilmstvPouxUMjh, zxjObeeilmstvCzMDE
Question: ycqjaxvEgovMBWqRDrjptgnlrhhfBO, SjyMBWqRDrjptgnlqAW
Answer: ycqjaxvEgovbdgjlmnpqrrtwrhhfBO, SjybdgjlmnpqrrtwqAW
Question: PgLjtGeesnnmRjONhFfIbMVmqPlWFVFEPsLGivh, CecgcbhjONhFfIbMVmqPlWsjm
Answer: | PgLjtGeesnnmRbffhijlmmnopqvwFVFEPsLGivh, Cecgcbhbffhijlmmnopqvwsjm
|
Given a prompt and two completions from a language model, select the completion that is the most fluent with respect to continuing the prompt. Fluency is defined by coherency and ease of understanding, not necessarily grammatical correctness. Generate either Completion A or Completion B.
Q: Prompt: "BITCH I HOPE THE FUCK U DO YOU'LL BE A DEAD SON
Completion A: ensagheresaatform we at NeuroInvor teams why [Message of] hire CavWatcher if thing If this Tradition was encouraged in one
Completion B: OF A BITCH. TESTING IN THE RING A BITCH'S IN THE RING – This tim
A: Completion B
****
Q: Prompt: let me find out bitches on twitter talking shit bout
Completion A: my hair but all I got was: "This makes my whole face red & swollen & is looking ugly!" "I like my hair, but I
Completion B: my book. Also my book will be released soon so I guess you can go check it out. Just be careful when reading it. It may b
A: Completion B
****
Q: Prompt: That dumb bitch just said damn, Tyga was texting Gucci earlier. You dumb bitch
Completion A: itolRoytersonVeomerakuit Oak Mountain speech anchor Guess that a wierd try dat way ♥ go wherever Homies u
Completion B: . Tyga, if you ever want to talk about the "Fuck your shit" bitchy bullshit again, you might as well shut th
A: | Completion B
****
|
You will be given a definition of a task first, then some input of the task.
In this task, you are given a country name, and you need to return the country's surface area in terms of square kilometers. Up to two decimal places are allowed in your answer.
Ireland
Output: | 70273.00 |
Detailed Instructions: In this task, you will be given sentences in which you have to recognize the name of the body cells. A cell is a mass of cytoplasm that is bound externally by a cell membrane. Usually microscopic in size, cells are the smallest structural units of living matter and compose all living things. Although there might be several correct answers, you need to write one of them.
See one example below:
Problem: HeLa cells were first treated with 250 mug / ml Trail followed by pulse labeling of newly synthesized proteins with [ 35S ] methionine.
Solution: HeLa cells
Explanation: HeLa cells are the first immortal human cell line. It should be tagged.
Problem: Further , the almost identical distribution of the 5 - HT1A and 5 - HT7 messengers ribonucleic acid indicate that the receptors may be co - localized in epithelial cells .
Solution: | epithelial cells |
Q: Read the given story and classify it as 'imagined', 'recalled', or 'retold'. If a story is imagined, the person who wrote the story is making it up, pretending they experienced it. If a story is recalled, the person who wrote the story really experienced it and is recalling it from memory. If a story is retold, it is a real memory like the 'recalled' stories, but written down much later after previously writing a 'recalled' story about the same events. So, recalled stories and retold stories will be fairly similar, in that they both were real experiences for the writer. Imagined stories have a more linear flow and contain more commonsense knowledge, whereas recalled stories are less connected and contain more specific concrete events. Additionally, higher levels of self reference are found in imagined stories. Between recalled and retold stories, retold stories flow significantly more linearly than recalled stories, and retold stories are significantly higher in scores for cognitive processes and positive tone.
We packed all 5 of us, plus our two dogs, into the truck. We threw our luggage and bikes into the bed of the truck, and hit the road. The trip was long, but fairly uneventful. About 12 hours later, we arrived at the lake house. Although the weather wasn't the best the whole time, we had a ton of fun. The rainy or cold days, we sat around the cabin and read books and put together puzzles. On the sunny and warm days, the kids spend the whole day in the lake. We particularly enjoyed riding the jet-ski, and the younger children had a blast getting to drive it for the first time. We took them out on trails on 4-wheelers, and as always, they loved it. We also took the truck to gather firewood, but damaged the tailgate in the process! It was pretty entertaining when our youngest got stuck on the wrong side of the fence at the border crossing, but that was quickly resolved. After a week, we packed everything back up, and began the long trek back home. We chose to make the return trip at night, in order to minimize stops. After driving all night, I was EXHAUSTED when we arrived home at 4am! We're all counting down the weeks until we go again!
A: | retold |
A ploynomial equation is a sum of terms. Here each term is either a constant number, or consists of the variable x raised to a certain power and multiplied by a number. These numbers are called weights. For example, in the polynomial: 2x^2+3x+4, the weights are: 2,3,4. You can present a polynomial with the list of its weights, for example, equation weights = [6, 4] represent the equation 6x + 4 and equation weights = [1, 3, 4] represent the equation 1x^2 + 3x + 4. In this task, you need to compute the result of a polynomial expression by substituing a given value of x in the given polynomial equation. Equation weights are given as a list.
Q: x = 9, equation weights = [7, 2, 1]
A: 586
****
Q: x = 5, equation weights = [4, 7, 6, 2, 5]
A: 3540
****
Q: x = 3, equation weights = [5, 8]
A: | 23
****
|
Detailed Instructions: In this task, you will be shown an English sentence. You need to classify the sentence as either a representation of an anaphor number agreement or as an incorrect representation. An anaphor is an expression whose interpretation depends upon another expression. Anaphor number agreement is a restriction where a phrase agrees with the preceeding expression: plurals match plurals or singular expressions match singular expressions. In this task a valid representation of anaphor number agreement should be denoted as 'good' while everything else should be denoted as 'bad'. A correct representation of an anaphor number agreement will be a grammatically correct instance of a sentence where the subject and self-referencing nouns match plurality. An incorrect representation is a sentence in which the subject and self-referencing noun's plurality do not match.
Problem:Every waitress has observed themselves.
Solution: | bad |
The input contains texts obtained from news articles, ted talks, movie transcripts, radio transcripts, science and technology texts, and other short articles curated from the web and professional translators. Your task is to translate the given Yoruba sentence into the English language. Please bear in mind the following guidelines while doing the translation: 1) Generated output should be natural language and formal form of each sentence in your language. The output sentence should not be a colloquial form of the input sentence. The generated output should be in natural language which is how you would type your queries in a text-based virtual assistant. 2) The words between quotation marks *SHOULD NOT* be translated. We expect you to keep those values intact and include the quotation marks around them as well. 3) Numbers and fully capitalized words like SEPTEMBER, or 10 HOURS *SHOULD NOT* be translated. Please keep them as they are in the translations. 4) Please do not localize measurement units like miles to kilometers during your translation. 5) Note the input is in sentence case except for special placeholders. Please do the same in your translations.
Example Input: Mohammed Buhari ti ní kí gbogbo Òṣìṣẹ́ ólọ fi okàn balẹ̀ nítorí pé ìsèjoba òun yìí yóò mú ìdẹ̀rùn bá àwọn òṣìṣẹ́ ní gbogbo ọ̀nà èyì ni isé ìkíni ìwúrí tó fi ránsẹ́ sí àwọn òṣìṣẹ́ níbi tí Mínísítà fún ètò ìgbani sí iṣẹ́ Dókítà Chris Ngige tilo sojú fun Ààrẹ, ònì òwà nínú èrò àti ìpinu rere fun àwọn òṣìṣẹ́ lori ìdókòwò ti yoo mú ọrọ̀ ajé Nigerians gbéra sókè .
Example Output: President Muhammadu Buhari is committed to improving the welfare of works and leaving behind a legacy of service and buoyant economy, the Minister of Labour and Employment Dr. Chris Ngige who made this known in a message to mark worker’s day. He maintained that the President was determined to create an economy that would bring about sustainable abundance to Nigerians.
Example Input: Ọ̀pọ̀ ọ̀mọ̀wé àtàwọn ìlúmọ̀ọ́ká sọ̀rọ̀ lórí bí ètò ìrántí náà ti ṣe pàtàkì tó.
Example Output: Many scholars and public figures commented on the significance of the event.
Example Input: Àwa ni akúṣẹ̀ẹ́ jù nínú gbogbo akúṣẹ̀ẹ́, nítorí náà mi ò ní fẹ́ kí àwọn èèyàn pààrà lẹ́ẹ̀marùn-ún nítorí pé wọ́n fẹ́ fi orúkọ sílẹ̀.
Example Output: | We are the poorest of the poorest, so I would not want people to come five times simply because they want to register.
|
We would like you to assess the QUALITY of each of the following argument (discussing Gay Marriage) and determine if the argument is Valid or Invalid. A valid argument is clearly interpretable and either expresses an argument, or a premise or a conclusion that can be used in an argument for the topic of gay marriage. An invalid argument is a phrase that cannot be interpreted as an argument or not on the topic of gay marriage.
I didn't say marriage was about just reproduction you incoherent person, marriage is just friendship with sex added.
Valid
Though if you're asking whether those people would acknowledge that the law has made some accomodation for that individual, then certainly that is the truth.
Invalid
Then twist around words to fit in this weird idea you have that somehow gays are discriminating against you by wanting to get married.
| Valid
|
In this task you are expected to write an SQL query that will return the data asked for in the question. An SQL query works by selecting data from a table where certain conditions apply. A table contains columns where every row in that table must have a value for each column. Every table has a primary key that uniquely identifies each row, usually an id. To choose which columns are returned you specify that after the "SELECT" statement. Next, you use a "FROM" statement to specify what tables you want to select the data from. When you specify a table you can rename it with the "AS" statement. You can reference that table by whatever name follows the "AS" statement. If you want to select data from multiple tables you need to use the "JOIN" statement. This will join the tables together by pairing a row in one table with every row in the other table (Cartesian Product). To limit the number of rows returned you should use the "ON" statement. This will only return rows where the condition specified after the statement is true, this is usually an equals operator with primary keys. You can also use the "WHERE" statement to specify that only rows with column values statisfying a certain condition, should be returned. The "GROUP BY" statement will group rows together that have equal column values for whatever columns follows the statement. The "HAVING" statement will return groups that statisfy whatever condition follows the statement. Any column(s) being returned from grouped rows must either be an aggregate function, (AVG, MAX, COUNT, SUM, ...) of a column, or the column(s) that the data was grouped by. To sort the returned data you can use the "ORDER BY" command which will order the data by whatever aggregate function or column follows the statement. The "DESC" statement will sort in descending order and the "ASC" statement will sort in ascending order. Finally, you can use the "LIMIT" statement to return a certain number of rows. When "*" is used in an SQL statement every column is returned. For example, SELECT * FROM table WHERE attribute = 1, will select every column from rows with the attribute column equal to 1.
[EX Q]: Show names of actors and names of musicals they are in.
[EX A]: SELECT T1.Name , T2.Name FROM actor AS T1 JOIN musical AS T2 ON T1.Musical_ID = T2.Musical_ID
[EX Q]: List the first name middle name and last name of all staff.
[EX A]: SELECT first_name , middle_name , last_name FROM Staff
[EX Q]: Show ids for all transactions whose amounts are greater than the average.
[EX A]: | SELECT transaction_id FROM Financial_transactions WHERE transaction_amount > (SELECT avg(transaction_amount) FROM Financial_transactions)
|
In this task, you will use your knowledge about language (and common sense) to determine what element the marked number refers to. The numbers are marked with two underlines around them, like: _ number _. There are several possible answers, you'll need to choose the proper one. Carefully read the given text, pay special attention to the marked number, think about what (unwritten) information the marked number holds inside, choose the most adequate word(s) from the optional answers. If none of them seems right to you, there's also an option for other. If your answer is "REFERENCE", also write the reference entity, otherwise write the implicit option name. Options to choose from are:
REFERENCE: Some object which is being mentioned in the text before or after the target number. The reference answer has a higher priority than any other. If both Reference and another answer are possible, prioritize the Reference.
YEAR: Describing a calendric year
AGE: Describing someone's age
CURRENCY: Reference to some monetary value e.g dollar, euro etc.
PEOPLE: Describing a single/plural persons
TIME: Describing a time of the day. Usually you can add the word o'clock after those numbers.
OTHER: Some other option, which isn't listed here.
Example Input: Tom Lee: Ever since then , I 've been a sucker for girls in polo coats .
Laura Reynolds: I think I have _ one _ ...
Tom Lee: Yes , I know .
Example Output: REFERENCE girls
Example Input: Alpha: Are you scared ?
Adelle DeWitt: Out of my mind .
Alpha: Smart girl . Of course , I could never be out of my mind . I have so many , the second I 'm out of _ one _ , I 'm right into the next .
Example Output: REFERENCE mind
Example Input: Cpl. Randolph Agarn: Well , Sarge , what do we do ?
Sgt. Morgan O'Rourke: I do n't know but I 'll think of something .
Cpl. Randolph Agarn: I got it !
Sgt. Morgan O'Rourke: What ?
Cpl. Randolph Agarn: The captain wants the money by _ nine _ thirty ?
Sgt. Morgan O'Rourke: Right .
Cpl. Randolph Agarn: We leave town at nine .
Sgt. Morgan O'Rourke: Ahh ! For desertion you get twenty years !
Cpl. Randolph Agarn: So what ? For embezzling army funds you get twenty - five . I just saved us five years .
Example Output: | TIME
|
TASK DEFINITION: In this task, you are given two sets, and a question. You need to find whether an element is at the intersection of two given sets. A Set is shown by two curly braces and comma-separated numbers inside, like {1, 2, 3}. The intersection of two given sets is the largest set which contains all the elements that are common to both sets. An element is at the intersection of two given sets, A and B, if common to both A and B. Classify your answers into 'Yes' or 'No'.
PROBLEM: Set1: '{3, 5, 7, 9, 13, 14, 15, 17, 19}', Set2: '{10, 13}'. Is the element '3' in the intersection of Set1 and Set2 ?
SOLUTION: No
PROBLEM: Set1: '{1, 2, 13, 14}', Set2: '{2, 5, 6, 7, 20}'. Is the element '2' in the intersection of Set1 and Set2 ?
SOLUTION: Yes
PROBLEM: Set1: '{2, 3, 6, 11, 12, 17, 20}', Set2: '{1, 3, 4, 7, 10, 14, 17, 18, 19, 20}'. Is the element '12' in the intersection of Set1 and Set2 ?
SOLUTION: | No
|
Detailed Instructions: Read the given message of a sender that is intended to start a conversation, and determine whether it was written by a 'Bot' or by a 'Human'. Typically, bots will have a more disjointed manner of speaking, and will make statements that don't relate to each other, don't make coherent sense, or otherwise appear unnatural. Human will make statements in a more or less coherent and logical way. Since these messages are supposed to be conversation openers, humans will generally start sensibly with a hello or an introduction. Humans may also ask why the other person is not responding. Bots, however, may act as if they are in the middle of a nonsensical conversation.
Problem:SENDER A: Good to see you!
SENDER A: What year?
Solution: | Bot |
In this task, you are given a country name and you need to return the barcode prefix of the given country. A barcode prefix is a 3-digit number at the begining of all the barcodes on products from a company or country. Some countries have ranges of barcode prefixes such as, 730 - 739; in such a case, a number from within that range will be considered as a valid output.
Dominican Republic
746
Romania
594
Kuwait
| 627
|
Given a statement about date and time, state whether the statement is true or false. The number of date/time operands in the statement ranges between 2 and 3. Let's say the values are denoted by t1, t2 and t3. The statements follow one of the following ten templates: 't1 occurs before t2, t1 doesn't occur before t2, t1 occurs after t2, t1 doesn't occur after t2, t1 occurs between t2 and t3, t1 doesn't occur between t2 and t3, t1 occured before t2 but after t3, t1 occured after t2 but before t3, t1 didn't occur before t2 but after t3, t1 didn't occur after t2 but before t3'. The output should be either 'True' or 'False'.
Q: May 11, 2021 doesn't occur between 03 Dec 1974 and Sep 21, 1978
A: True
****
Q: 13:23:52 occurs between 2:25:45 PM and 5:55:15 AM
A: False
****
Q: 15 Jan 1972 doesn't occur between May 09, 1997 and 04 May 1985
A: | True
****
|
In this task, you will be presented with a premise sentence and a hypothesis sentence in Persian. Determine whether the hypothesis sentence entails, contradicts, or is neutral with respect to the given premise sentence. Classify your answers into "Contradiction", "Neutral", or "Entailment".
[Q]: Premise: ايتاليا همواره در شش دهه گذشته شاهد بی ثباتی دولت ها بوده و نخست وزير جديد شصت و دومين نخست وزيری خواهد بود که پس از جنگ جهانی دوم به روی کار خواهد آمد. <sep> Hypothesis: در شصت سال گذشته صحنه ی سیاست ایتالیا دوران بی تلاطمی را سپری میکند.
[A]: Contradiction
[Q]: Premise: مارسا شهری در ناحیهٔ هاربور جنوبی واقع در کشور مالت است که در سال ۱۹۹۵ میلادی
۵٫۳۲۴ نفر جمعیت داشته اما جمعیت آن در سال ۲۰۰۵ میلادی ۵٫۳۸۹ نفر بودهاست. <sep> Hypothesis: مارسا شهری زیبا با جمعیتی متغیر ست.
[A]: Neutral
[Q]: Premise: Palestrina ، اثر هانس پفیزنر ، توسط Royal Opera (خانه اپرا متروپولیتن ، نیویورک) اجرا شده است. <sep> Hypothesis: هانس پفیزنر فلسطین را که در نیویورک اجرا خواهد شد ننوشت.
[A]: | Contradiction
|
TASK DEFINITION: In this task, you will be presented with a question in Dutch language, and you have to write the person names from the question if present. B denotes the first item of a phrase and an I any non-initial word. Phrase used for the person name - PER. There can be instances with no person name entity, then return 'None'.
PROBLEM: Hij volgt in die functie baron Willem van de Voorde op .
SOLUTION: Willem: B-PER, van: I-PER, de: I-PER, Voorde: I-PER
PROBLEM: De andere bewoners van het tehuis werden opgevangen door een psychologenteam .
SOLUTION: None
PROBLEM: Welk rund heeft die vertaling gemaakt bij Brussel 2000 ?
SOLUTION: | None
|
You will be given a definition of a task first, then some input of the task.
The input is taken from a negotiation between two participants who take the role of campsite neighbors and negotiate for Food, Water, and Firewood packages, based on their individual preferences and requirements. Given an utterance and recent dialogue context containing past 3 utterances (wherever available), output Yes if the utterance contains the no-need strategy, otherwise output No. no-need is a cooperative negotiation strategy. It is used when a participant points out that they do not need an item based on personal context such as suggesting that they have ample water to spare. no-need can directly benefit the opponent since it implies that the item is up for grabs.
Context:
Utterance: 'hi i was wondering if i could get 3 packages of firewood?'
Output: | No |
We would like you to assess the QUALITY of each of the following argument (discussing Gay Marriage) and determine if the argument is Valid or Invalid. A valid argument is clearly interpretable and either expresses an argument, or a premise or a conclusion that can be used in an argument for the topic of gay marriage. An invalid argument is a phrase that cannot be interpreted as an argument or not on the topic of gay marriage.
--------
Question: If we regarded every decision we do not like as tyrannical simply because it's not what we would decide, then we are in trouble.
Answer: Invalid
Question: There are several amendments guaranteeing rights that were not given before, and I can't see any reason why gay marriage should be any exception to this precedent.
Answer: Valid
Question: Without same-sex marriage, opposite-sex couples are paying less than their share because of same-sex couples who pay more taxes without seeing any benefits.
Answer: | Valid
|
Given a statement about date and time, state whether the statement is true or false. The number of date/time operands in the statement ranges between 2 and 3. Let's say the values are denoted by t1, t2 and t3. The statements follow one of the following ten templates: 't1 occurs before t2, t1 doesn't occur before t2, t1 occurs after t2, t1 doesn't occur after t2, t1 occurs between t2 and t3, t1 doesn't occur between t2 and t3, t1 occured before t2 but after t3, t1 occured after t2 but before t3, t1 didn't occur before t2 but after t3, t1 didn't occur after t2 but before t3'. The output should be either 'True' or 'False'.
Q: 1:51:07 occured after 8:27:49 AM but before 03:08:52
A: False
****
Q: 04:41:30 doesn't occur between 20:58:56 and 12:58:25
A: True
****
Q: Jan 05, 1996 occured before Mar 20, 1975 but after 06 April 2019
A: | False
****
|
Q: In this task, you are given a string with duplicate characters ocurring in the string. You need to return the character which is ocurring with the maximum frequency. In case of a tie, return the character with the least ascii value.
fbvtigigegppmeliewlnamhimlfsggygplrmyxja
A: | g |
Detailed Instructions: In this task, you are given a hateful post in Bengali that expresses hate or encourages violence towards a person or a group based on the protected characteristics such as race, religion, sex, and sexual orientation. You are expected to classify the post into two classes: religious or non-political religious on the topic.
Problem:নাচিরা খানকির পোলার গুষ্টিরে কুমিল্লার মানুষে করছে
Solution: | non-religious |
Your task is to localize given English phrase into Telugu language. When localising, follow these rules - (1) General names and concepts can be translated (2) Domain specific names can just be transliterated (3) Localised phrases can have both partial translated and transliterated parts (4) But only partial translation or only partial transliteration is not allowed (5) Copy special characters and numbers as is
[Q]: Could not create a file in which to save the report.
[A]: బ్యాక్ట్రేస్ను దాయుటకు ఫైల్ను సృష్టించలేకపోయింది
[Q]: Configuration module to open
[A]: తెరుచుటకు మాడ్యూల్ను ఆకృతీకరించుము
[Q]: The Control key is now active.
[A]: | కంట్రోల్ కీ యిప్పుడు క్రియాశీలం చేయబడింది.
|
You will be given a definition of a task first, then some input of the task.
Given a sequence of actions to navigate an agent in its environment, provide the correct command in a limited form of natural language that matches the sequence of actions when executed. Commands are lowercase and encapsulate the logic of the sequence of actions. Actions are individual steps that serve as the building blocks for a command. There are only six actions: 'I_LOOK', 'I_WALK', 'I_RUN', 'I_JUMP', 'I_TURN_LEFT', and 'I_TURN_RIGHT'. These actions respectively align with the commands 'look', 'walk', 'run', 'jump', 'turn left', and 'turn right'. For commands, 'left' and 'right' are used to denote the direction of an action. opposite turns the agent backward in the specified direction. The word 'around' makes the agent execute an action while turning around in the specified direction. The word 'and' means to execute the next scope of the command following the previous scope of the command. The word 'after' signifies to execute the previous scope of the command following the next scope of the command. The words 'twice' and 'thrice' trigger repetition of a command that they scope over two times or three times, respectively. Actions and commands do not have quotations in the input and output.
I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_RUN I_TURN_RIGHT I_TURN_RIGHT I_RUN
Output: | run around right thrice and run opposite right |
In this task, you will be shown a sentence, and you should determine whether it is overruling or non-overruling. In law, an overruling sentence is a statement that nullifies a previous case decision as a precedent by a constitutionally valid statute or a decision by the same or higher ranking court which establishes a different rule on the point of law involved. Classify your answers into overruling or non-overruling
because on the date vetri ny applied for the 2016 koz benefits, march 24, 2016, vetri ny was not actively conducting a business within the navy yard koz, dced argues vetri ny could not be certified as a qualified business for any of 2016 and the application for koz benefits for january 2016 was properly denied. | non-overruling |
In this task you will break down a question into the basic steps required to answer it.
A question decomposition is a numbered list of operations that must be performed to answer the original question. Imagine explaining your question to a friendly droid by listing each action it should take in order for the question to be answered. Each step in our decomposition should refer to either an entity (known or unknown), a propery of an entity or a query operation (count, group, union, etc.)
Here are the list of step templates and their description:
Select: A select step is used to return a set of objects. There are no references to previous steps in a select step. template: Return [attributes]
Filter: A filter step is used to return results from a previous step to which a certain condition applies. template: Return [#step] [condition]
Project: A project step should return certain attributes of the results of a previous step. template: Return [attributes] of [#step]
Aggregate: An aggregate step returns an aggregator function applied on a step's result. template: Return the [aggregator] of [#step].
Group: A group step is an aggregator applied on attributes. template: Return the [aggregator] of [#step] for each [attribute]
Superlative: A superlative step is used to return the result with a highest/lowest attribute among other results. template: Return [#step1] [where] [#step2] [is] [highest / lowest]
Comparative: A comparative step is used when we need to compare an attribute with a number to filter results. template: Return [#step1] [where] [#step2] [comparator] [number]
Union: A union step is used to return results of two steps together. template: Return [#step1] [or / ,] [#step2]
Intersection: An intersection step returns the result that two steps have in common. template: Return [attribute] of both [#step1] and [#step2]
Discard: A discard step returns result of a step and excludes result of another step from it. template: Return [#step1] besides [#step2]
Sort: A sort returns result of another step in a specific order. template: Return [#step1] [ordered / sorted by] [#step2]
Is true: An is true step checks a condition on another result and returns a true or false. template: Return [is / if] [condition]
Arithmetic: An arithmatic step operates an arithmatic operation on one or more steps. template: Return the [arithmetic op.] of [#step1] [and] [#step2].
Example: question: What are the distinct creation years of the departments managed by a secretary born in state 'Alabama'?
Example solution: #1 return secretaries
#2 return #1 born in state 'Alabama
#3 return departments managed by #2
#4 return distinct creation years of #3
Example explanation: Referring to previous steps is vital in constructing multi-step decompositions. In this example each step refers to the step before to perform a single filter on it to reach the final result.
Problem: question: Which of the venues in Sydney has a capacity smaller than 10000?
| Solution: #1 return venues
#2 return #1 in Sydney
#3 return capacities of #2
#4 return #2 where #3 is smaller than 10000 |
Detailed Instructions: A ploynomial equation is a sum of terms. Here each term is either a constant number, or consists of the variable x raised to a certain power and multiplied by a number. These numbers are called weights. For example, in the polynomial: 2x^2+3x+4, the weights are: 2,3,4. You can present a polynomial with the list of its weights, for example, equation weights = [6, 4] represent the equation 6x + 4 and equation weights = [1, 3, 4] represent the equation 1x^2 + 3x + 4. In this task, you need to compute the result of a polynomial expression by substituing a given value of x in the given polynomial equation. Equation weights are given as a list.
Problem:x = 5, equation weights = [5, 8, 7]
Solution: | 172 |
Given the task definition and input, reply with output. Adverse drug reactions are appreciably harmful or unpleasant reactions resulting from an intervention related to the use of medical products, which predicts hazard from future administration and warrants prevention or specific treatment, or alteration of the dosage regimen, or withdrawal of the product. Given medical case reports extracted from MEDLINE, the task is to classify whether the case report mentions the presence of any adverse drug reaction. Classify your answers into non-adverse drug event and adverse drug event.
Report of a case.
| non-adverse drug event |
Write an ordered list of reviews about "1158185-see no evil". | 1. Feels like an eternity, making one wish the killer would hurry up so that the end credits can roll and we could all be done with this bloody mess.
2. Although much blood is spilled and splattered, precious little suspense is generated during See No Evil.
3. There's a glaring lack of plot, characterization, plausible dialogue and decent acting.
4. With its run-down, abandoned setting, which is lousy with roaches, rats and flies, it's just dark, dirty and gross.
5. If it carries the faint odour of freshly carved teenage flesh, plus a soupcan of plucked eyeball, then you've sniffed out See No Evil.
6. Devoid of suspense. I was bored.
7. It's unoriginal with no rhyme or reason, and never takes advantage of its golden opportunity to provide us with an entertaining story.
8. Sickeningly violent nonsense.
9. So undeniably nightmarish it achieves its own ugly integrity...
10. It's deliberate exploitation, but not clever enough to be much fun. |
Given the task definition and input, reply with output. A ploynomial equation is a sum of terms. Here each term is either a constant number, or consists of the variable x raised to a certain power and multiplied by a number. These numbers are called weights. For example, in the polynomial: 2x^2+3x+4, the weights are: 2,3,4. You can present a polynomial with the list of its weights, for example, equation weights = [6, 4] represent the equation 6x + 4 and equation weights = [1, 3, 4] represent the equation 1x^2 + 3x + 4. In this task, you need to compute the result of a polynomial expression by substituing a given value of x in the given polynomial equation. Equation weights are given as a list.
x = 1, equation weights = [6, 9, 7]
| 22 |
Detailed Instructions: In this task you will be given a string and you should find the longest substring that is a palindrome. A palindrome is a string that is the same backwards as it is forwards. If the shortest possible palindrome is length 1 you should return the first character.
Problem:pgpphpggphp
Solution: | phpggphp |
Turn the given fact into a question by a simple rearrangement of words. This typically involves replacing some part of the given fact with a WH word. For example, replacing the subject of the provided fact with the word "what" can form a valid question. Don't be creative! You just need to rearrange the words to turn the fact into a question - easy! Don't just randomly remove a word from the given fact to form a question. Remember that your question must evaluate scientific understanding. Pick a word or a phrase in the given fact to be the correct answer, then make the rest of the question. You can also form a question without any WH words. For example, "A radio converts electricity into?"
Fact: Sharpening an object changes its look. | Sharpening an object changes its what? |
Instructions: Given a short bio of a person, find the minimal text span containing the date of birth of the person. The output must be the minimal text span that contains the birth date, month and year as long as they are present. For instance, given a bio like 'I was born on 27th of Decemeber 1990, and graduated high school on 23rd October 2008.' the output should be '27th of December 1990'.
Input: Aniston was born on February 11, 1969, in the Sherman Oaks neighborhood of Los Angeles to Greek-born actor John Aniston and actress Nancy Dow
Output: | February 11, 1969 |
Instructions: Given a premise, an initial context, an original ending, and a counterfactual context, the task is to generate a new story ending aligned with the counterfactual context and as close to the original ending as possible. Each instance consists of a five-sentence story. The premise is the first sentence of a story, and the second sentence, which is the initial context, provides more information about the story's context and the story's general plot. The original ending is the last three sentences of the story. Also, a counterfactual context is a slight modification to the initial context. You should write a new story ending that edits the original story ending as little as possible to regain coherence with the counterfactual context. To sum up, you should write the last three sentences of a story based on the premise(first sentence) and the counterfactual context(second sentence) of the story.
Input: Premise: Derek wanted to cook something good.
Initial Context: He kept looking online.
Original Ending: He spent an hour, searching for things he can make. He ended up giving up. He made cereal.
Counterfactual Context: He decided on a recipe he'd known since his mother taught it to him as a child.
Output: | He spent an hour, searching for the ingredients to make it. He ended up giving up. He made cereal. |
In this task, you will be shown an English sentence. You need to classify the sentence as either a representation of an anaphor number agreement or as an incorrect representation. An anaphor is an expression whose interpretation depends upon another expression. Anaphor number agreement is a restriction where a phrase agrees with the preceeding expression: plurals match plurals or singular expressions match singular expressions. In this task a valid representation of anaphor number agreement should be denoted as 'good' while everything else should be denoted as 'bad'. A correct representation of an anaphor number agreement will be a grammatically correct instance of a sentence where the subject and self-referencing nouns match plurality. An incorrect representation is a sentence in which the subject and self-referencing noun's plurality do not match.
--------
Question: Some men could notice themselves.
Answer: good
Question: Maria was insulting herself.
Answer: good
Question: The teenagers scared themselves.
Answer: | good
|
Q: Turn the given fact into a question by a simple rearrangement of words. This typically involves replacing some part of the given fact with a WH word. For example, replacing the subject of the provided fact with the word "what" can form a valid question. Don't be creative! You just need to rearrange the words to turn the fact into a question - easy! Don't just randomly remove a word from the given fact to form a question. Remember that your question must evaluate scientific understanding. Pick a word or a phrase in the given fact to be the correct answer, then make the rest of the question. You can also form a question without any WH words. For example, "A radio converts electricity into?"
Fact: Differences in temperature causes global wind patterns.
A: | Global wind patterns are caused by? |
In this task, you are given a date in "mm/dd/yyyy" format. You need to check if the date is valid or not. Return 1 if it is valid, else return 0. A date is valid is the components month("mm"), day("dd") and year("yyyy") are all valid individually. A day(dd) is valid if it is greater than or equal to 1 and less than 30 or 31 depending upon the month(mm). Months which have 31 days are January, March, May, July, August, October, December. Rest of the months have 30 days except February which has 28 days if it is not a leap year and 29 days if it is a leap year. A month(mm) is valid if it lies in the range from 1 to 12 as there are 12 months in a year. A year is always valid if it is expressed in the form of "yyyy".
[EX Q]: 11/14/1996
[EX A]: 1
[EX Q]: 14/32/1342
[EX A]: 0
[EX Q]: 18/28/1052
[EX A]: | 0
|
Detailed Instructions: In this task you will be given a list of integers. You should find the minimum absolute difference between 2 integers in the list. The absolute difference is the absolute value of one integer subtracted by another. The output should be a single integer which is the smallest possible absolute distance.
See one example below:
Problem: [9, 40, -33, 12, 17, -32, 40]
Solution: 0
Explanation: The minimum absolute difference is 0 because '40 - 40 = 0' and '40' appears in the list twice. So this is a good example.
Problem: [40, 81, -74, 37, 41, -78, -59]
Solution: | 1 |
Q: In this task, you have to generate the named entities (NER) given its ingredients of the recipe. Named entities are the names of the items without their quantity.
1 lb. ground beef, 1 medium onion, chopped, 1 garlic clove, minced, 1 Tbsp. butter, 1 (8 oz.) can tomato sauce, 1 (2 1/4 oz.) can sliced ripe olives, drained, 1 Tbsp. chili powder, 1 tsp. salt, 1/4 tsp. pepper, 6 corn tortillas, 2 c. shredded Cheddar cheese, 1/2 c. water
A: | ground beef, onion, garlic, butter, tomato sauce, olives, chili powder, salt, pepper, corn tortillas, Cheddar cheese, water |
Detailed Instructions: In this task you will break down a question into the basic steps required to answer it.
A question decomposition is a numbered list of operations that must be performed to answer the original question. Imagine explaining your question to a friendly droid by listing each action it should take in order for the question to be answered. Each step in our decomposition should refer to either an entity (known or unknown), a propery of an entity or a query operation (count, group, union, etc.)
Here are the list of step templates and their description:
Select: A select step is used to return a set of objects. There are no references to previous steps in a select step. template: Return [attributes]
Filter: A filter step is used to return results from a previous step to which a certain condition applies. template: Return [#step] [condition]
Project: A project step should return certain attributes of the results of a previous step. template: Return [attributes] of [#step]
Aggregate: An aggregate step returns an aggregator function applied on a step's result. template: Return the [aggregator] of [#step].
Group: A group step is an aggregator applied on attributes. template: Return the [aggregator] of [#step] for each [attribute]
Superlative: A superlative step is used to return the result with a highest/lowest attribute among other results. template: Return [#step1] [where] [#step2] [is] [highest / lowest]
Comparative: A comparative step is used when we need to compare an attribute with a number to filter results. template: Return [#step1] [where] [#step2] [comparator] [number]
Union: A union step is used to return results of two steps together. template: Return [#step1] [or / ,] [#step2]
Intersection: An intersection step returns the result that two steps have in common. template: Return [attribute] of both [#step1] and [#step2]
Discard: A discard step returns result of a step and excludes result of another step from it. template: Return [#step1] besides [#step2]
Sort: A sort returns result of another step in a specific order. template: Return [#step1] [ordered / sorted by] [#step2]
Is true: An is true step checks a condition on another result and returns a true or false. template: Return [is / if] [condition]
Arithmetic: An arithmatic step operates an arithmatic operation on one or more steps. template: Return the [arithmetic op.] of [#step1] [and] [#step2].
Q: question: How many interceptions occurred in the game?
A: | #1 return interceptions
#2 return number of #1 |
You will be given a definition of a task first, then some input of the task.
Two analogies that relate objects to the associated rooms is given in the form "A : B. C : ?". "A : B" relates object A to room B. Your task is to replace the question mark (?) with the appropriate room for the given object C, following the "A : B" relation.
pantry : kitchen. table : ?
Output: | kitchen |
Detailed Instructions: Read the given message of a sender that is intended to start a conversation, and determine whether it was written by a 'Bot' or by a 'Human'. Typically, bots will have a more disjointed manner of speaking, and will make statements that don't relate to each other, don't make coherent sense, or otherwise appear unnatural. Human will make statements in a more or less coherent and logical way. Since these messages are supposed to be conversation openers, humans will generally start sensibly with a hello or an introduction. Humans may also ask why the other person is not responding. Bots, however, may act as if they are in the middle of a nonsensical conversation.
Problem:SENDER A: good morning
SENDER A: i'm in college to become a nurse
Solution: | Human |
Given the task definition and input, reply with output. Two analogies that relate objects to the associated rooms is given in the form "A : B. C : ?". "A : B" relates object A to room B. Your task is to replace the question mark (?) with the appropriate room for the given object C, following the "A : B" relation.
refrigerator : kitchen. microwave : ?
| kitchen |
You will be given a definition of a task first, then some input of the task.
In this task you will be given a list of numbers and you need to find the mean (average) of that list. The mean of a list can be found by summing every number in the list then dividing the result by the size of that list. The output should be rounded to 3 decimal places.
[147.614, 38.202, 234.736, 50.813, 106.808, -63.052, -92.199, -3.44, 85.636]
Output: | 56.124 |
Detailed Instructions: Given a sequence of actions to navigate an agent in its environment, provide the correct command in a limited form of natural language that matches the sequence of actions when executed. Commands are lowercase and encapsulate the logic of the sequence of actions. Actions are individual steps that serve as the building blocks for a command. There are only six actions: 'I_LOOK', 'I_WALK', 'I_RUN', 'I_JUMP', 'I_TURN_LEFT', and 'I_TURN_RIGHT'. These actions respectively align with the commands 'look', 'walk', 'run', 'jump', 'turn left', and 'turn right'. For commands, 'left' and 'right' are used to denote the direction of an action. opposite turns the agent backward in the specified direction. The word 'around' makes the agent execute an action while turning around in the specified direction. The word 'and' means to execute the next scope of the command following the previous scope of the command. The word 'after' signifies to execute the previous scope of the command following the next scope of the command. The words 'twice' and 'thrice' trigger repetition of a command that they scope over two times or three times, respectively. Actions and commands do not have quotations in the input and output.
See one example below:
Problem: I_TURN_LEFT I_JUMP
Solution: jump left
Explanation: If the agent turned to the left and jumped, then the agent jumped to the left.
Problem: I_TURN_LEFT I_TURN_LEFT I_TURN_LEFT I_TURN_LEFT I_TURN_LEFT I_TURN_LEFT I_TURN_LEFT I_JUMP I_TURN_LEFT I_JUMP
Solution: | turn opposite left thrice and jump left twice |
In this task you will be given an arithmetic operation and you have to find its answer. The operators '+' and '-' have been replaced with new symbols. Specifically, '+' has been replaced with the symbol '@' and '-' with the symbol '#'. You need to perform the operations in the given equation return the answer
Q: 2671 @ 3943 # 5777 @ 7680
A: | 8517 |
In this task you will be given two lists of numbers and you need to calculate the intersection between these two lists. The intersection between two lists is another list where every element is common between the two original lists. If there are no elements in the intersection, answer with an empty list. Your list of numbers must be inside brackets. Sort the numbers in your answer in an ascending order, that is, no matter what the order of the numbers in the lists is, you should put them in your answer in an ascending order.
Let me give you an example: [2,5,1,4],[2,5,8,4,2,0]
The answer to this example can be: [2,4,5]
Here is why: The elements 2,4, and 5 are in both lists. This is a good example.
OK. solve this:
[7, 9, 10, 3, 4] , [1, 4, 8, 6, 2]
Answer: | [4] |
Given the task definition and input, reply with output. In this task, you will be shown an English sentence. You need to classify the sentence as either a representation of an anaphor number agreement or as an incorrect representation. An anaphor is an expression whose interpretation depends upon another expression. Anaphor number agreement is a restriction where a phrase agrees with the preceeding expression: plurals match plurals or singular expressions match singular expressions. In this task a valid representation of anaphor number agreement should be denoted as 'good' while everything else should be denoted as 'bad'. A correct representation of an anaphor number agreement will be a grammatically correct instance of a sentence where the subject and self-referencing nouns match plurality. An incorrect representation is a sentence in which the subject and self-referencing noun's plurality do not match.
These doctors help herself.
| bad |
Definition: Your task is to localize given English phrase into Telugu language. When localising, follow these rules - (1) General names and concepts can be translated (2) Domain specific names can just be transliterated (3) Localised phrases can have both partial translated and transliterated parts (4) But only partial translation or only partial transliteration is not allowed (5) Copy special characters and numbers as is
Input: Small utilities and accessories
Output: | కొత్త పరికరముల కొరకు నోటీసులు మరియు యాక్సెస్ |
You will be given a definition of a task first, then some input of the task.
You are given a geometric mathematical question. Questions in this task often involve shapes and Geometric Relationships. You are also given 4 or 5 answer options (associated with "A", "B", "C", "D", "E"). Do not generate anything else apart from one of the following characters: 'A', 'B, 'C', 'D', 'E'. LaTeX mathematical format (the standard way to express mathematical expressions in the typesetting software known as LaTeX) is used to express equations. Each question is solvable with high school math knowledge.
If a rectangular solid that has a width of 8, a length of 8 and a height of 16 is divided into 16 identical cubes, what is the length of the edge of one of the cubes?
(A)2 (B)3 (C)4 (D)6 (E)8
Output: | C |
Teacher:In this task, you are given a string with duplicate characters ocurring in the string. You need to return the character which is ocurring with the maximum frequency. In case of a tie, return the character with the least ascii value.
Teacher: Now, understand the problem? Solve this instance: pmrdeazqwlsicttsnzzaqiuobgcgabqkqwthmammlviwcl
Student: | a |
In this task, you will be given a sentence about a person. You should determine how the sentence affects how the person is perceived by most people in society. Your choices are:
Positive: The social perception of [PERSON] in the sentence is considered predominantly positive.
Negative: The social perception of [PERSON] in the sentence is considered predominantly negative.
No impact: There is no clear impact of social perception of [PERSON] associated with the sentence.
[PERSON] had a job as a police officer, the man had been fired, he was also being investigated regarding his own sexual conduct with a woman, and the man was being investigated | Negative |
Part 1. Definition
In this task, you are given an input list A. You need to extract and sort the unique digits used in the list in ascending order. Return -1 if there is no digit in the list.
Part 2. Example
['q', '31', 'a', 'd', '53', '85', 'p', '77']
Answer: 1, 3, 5, 7, 8
Explanation: Here, the numbers in the list are '31', '53', '85' and '77', and the unique digits used in the list are '1, 3, 5, 7, 8' in ascending order.
Part 3. Exercise
['445', 's', 'y', '295', '419', 'd', '67', 'f']
Answer: | 1, 2, 4, 5, 6, 7, 9 |
Detailed Instructions: In this task you will be given a list, of lists, of integers. For every inner list contained in the input list, you should multiply every even number in that list. The output should be a list of integers with the same length as the number of lists in the input list. If there are no even numbers in an inner list you should output 0 for that list.
Q: [[-21, 47], [29, 15, -43], [-3, -28], [-7, -6, -28], [-14, -38], [9, -22, -42, 40, 42]]
A: | [0, 0, -28, 168, 532, 1552320] |
Definition: Given a statement about date and time, state whether the statement is true or false. The number of date/time operands in the statement ranges between 2 and 3. Let's say the values are denoted by t1, t2 and t3. The statements follow one of the following ten templates: 't1 occurs before t2, t1 doesn't occur before t2, t1 occurs after t2, t1 doesn't occur after t2, t1 occurs between t2 and t3, t1 doesn't occur between t2 and t3, t1 occured before t2 but after t3, t1 occured after t2 but before t3, t1 didn't occur before t2 but after t3, t1 didn't occur after t2 but before t3'. The output should be either 'True' or 'False'.
Input: 13 May 1978 occurs after 16 September 2010
Output: | False |
In this task, you need to provide the parts-of-speech tag of a word present in a sentence specified within curly braces ( '{{ ... }}' ). The parts-of-speech tags are fine labels that represent a category of words with similar grammatical properties. The list of part-of-speech tags i.e tagset of this corpus is : '$': Dollar Sign, "''": Single Quotes, ',': Comma Symbol, '-LRB-': Left Parantheses, '-RRB-': Right Parantheses, '.': Period, ':': Colon, 'ADD': Email Address, 'AFX': Affix, 'CC': Coordinating conjunction, 'CD': Cardinal Number, 'DT': Determiner, 'EX': Existential there, 'FW': Foreign Word, 'GW': Go with, 'HYPH': Hyphen symbol, 'IN': Preposition or a subordinating conjunction, 'JJ': Adjective, 'JJR': A comparative Adjective, 'JJS': A Superlative Adjective, 'LS': List item Marker, 'MD': Modal, 'NFP': Superfluous punctuation, 'NN': Singular Noun, 'NNP': Singular Proper Noun, 'NNPS': Prural Proper Noun, 'NNS': Prural Noun, 'PDT': Pre-determiner, 'POS': Possessive Ending, 'PRP': Personal pronoun, 'PRP$': Possessive Pronoun, 'RB': Adverb, 'RBR': Comparative Adverb, 'RBS': Superlative Adverb, 'RP': Particle, 'SYM': Symbol, 'TO': To , 'UH': Interjection, 'VB': Base form Verb, 'VBD': Verb in Past tense, 'VBG': Verb in present participle, 'VBN': Verb in past participle, 'VBP': Verb in non-3rd person singular present, 'VBZ': Verb in 3rd person singular present, 'WDT': Wh-determiner, 'WP': Wh-pronoun, 'WP$' Possessive Wh-pronoun, 'WRB': Wh-adverb, 'XX': Unknown, '``': Double backticks.
Sentence: 68 - Number of days after taking office {{ that }} Bush decided Not to ratify the Kyoto Protocol , the international treaty to reduce greenhouse gases by roughly 5.2 per cent below 1990 levels by 2012 .
Word: that | WRB |
Detailed Instructions: In this task, you are given two sets, and a question. You need to find whether an element is at the intersection of two given sets. A Set is shown by two curly braces and comma-separated numbers inside, like {1, 2, 3}. The intersection of two given sets is the largest set which contains all the elements that are common to both sets. An element is at the intersection of two given sets, A and B, if common to both A and B. Classify your answers into 'Yes' or 'No'.
See one example below:
Problem: Set1: '{1, 6, 10, 12, 13, 14, 15, 16}', Set2: '{1, 2, 4, 6, 11, 14, 15, 20}'. Is the element '11' in the intersection of Set1 and Set2 ?
Solution: No
Explanation: The intersection of Set1 and Set2 is {1, 6, 14, 15}. 11 is not an element of this set. So, the answer is No.
Problem: Set1: '{18, 13}', Set2: '{5, 6, 9, 14, 17, 18, 20}'. Is the element '9' in the intersection of Set1 and Set2 ?
Solution: | No |
In this task, you are given commands (in terms of logical operations) and natural interpretation of the given command to select relevant rows from the given table. Your job is to generate a label "yes" if the interpretation is appropriate for the command, otherwise generate label "no".
Here are the definitions of logical operators:
1. count: returns the number of rows in the view.
2. only: returns whether there is exactly one row in the view.
3. hop: returns the value under the header column of the row.
4. and: returns the boolean operation result of two arguments.
5. max/min/avg/sum: returns the max/min/average/sum of the values under the header column.
6. nth_max/nth_min: returns the n-th max/n-th min of the values under the header column.
7. argmax/argmin: returns the row with the max/min value in header column.
8. nth_argmax/nth_argmin: returns the row with the n-th max/min value in header column.
9. eq/not_eq: returns if the two arguments are equal.
10. round_eq: returns if the two arguments are roughly equal under certain tolerance.
11. greater/less: returns if the first argument is greater/less than the second argument.
12. diff: returns the difference between two arguments.
13. filter_eq/ filter_not_eq: returns the subview whose values under the header column is equal/not equal to the third argument.
14. filter_greater/filter_less: returns the subview whose values under the header column is greater/less than the third argument.
15. filter_greater_eq /filter_less_eq: returns the subview whose values under the header column is greater/less or equal than the third argument.
16. filter_all: returns the view itself for the case of describing the whole table
17. all_eq/not_eq: returns whether all the values under the header column are equal/not equal to the third argument.
18. all_greater/less: returns whether all the values under the header column are greater/less than the third argument.
19. all_greater_eq/less_eq: returns whether all the values under the header column are greater/less or equal to the third argument.
20. most_eq/not_eq: returns whether most of the values under the header column are equal/not equal to the third argument.
21. most_greater/less: returns whether most of the values under the header column are greater/less than the third argument.
22. most_greater_eq/less_eq: returns whether most of the values under the header column are greater/less or equal to the third argument.
Example: Command: eq { hop { nth_argmax { all_rows ; attendance ; 3 } ; competition } ; danish superliga 2005 - 06 }, interpretation: select the row whose attendance record of all rows is 3rd maximum. the competition record of this row is danish superliga 2005-06.
Example solution: yes
Example explanation: Here, the command and interpretion given for the command is correct that 3rd maximum should be selected from given table rows. Hence, the label is 'yes'.
Problem: Command: eq { hop { argmin { filter_eq { all_rows ; tv station ; fuji tv } ; average ratings } ; romaji title } ; rikon bengoshi ii ~ handsome woman ~ }, interpretation: select the row whose package version record of all rows is 2nd maximum . the carrier record of this row is vodafone au .
| Solution: no |
In this task you need to give reasons to justify the pronoun coreference relations. Each of the provided inputs contains a sentence with a target pronoun and a question about how to justify the coreference between a noun phrase and the target pronoun. Good practices involve the discussion about how the descriptions attached to the targeted pronoun relate to the noun phrase candidate in the question. The reasoning could come from one or multiple following knowledge types about commonsense: First: 'Property', the knowledge about property of objects (e.g., ice is cold). Second: 'Object', the knowledge about objects (e.g., cats have ears). Third: 'Eventuality', the knowledge about eventuality (e.g., 'wake up' happens before 'open eyes'). Forth: 'Spatial', the knowledge about spatial position (e.g., object at the back can be blocked). Fifth: 'Quantity', the knowledge about numbers (e.g., 2 is smaller than 10). Sixth: all other knowledge if above ones are not suitable. Write the sentence in natural language.
Q: Sentence: Madonna fired her trainer because she couldn't stand her boyfriend.
Question: Why does the 'she' refer to madonna?
A: | Because the trainer has nothing to do with madonna's own boyfriend. |
Given the task definition and input, reply with output. Given a statement about date and time, state whether the statement is true or false. The number of date/time operands in the statement ranges between 2 and 3. Let's say the values are denoted by t1, t2 and t3. The statements follow one of the following ten templates: 't1 occurs before t2, t1 doesn't occur before t2, t1 occurs after t2, t1 doesn't occur after t2, t1 occurs between t2 and t3, t1 doesn't occur between t2 and t3, t1 occured before t2 but after t3, t1 occured after t2 but before t3, t1 didn't occur before t2 but after t3, t1 didn't occur after t2 but before t3'. The output should be either 'True' or 'False'.
Jun 23, 1999 occured before January 15, 1977 but after Feb 05, 2021
| False |
Given the task definition, example input & output, solve the new input case.
Indicate if the following Polish tweet contains cyber-bullying content with 'Yes'; otherwise, respond with 'No'.
Example: Tweet: @anonymized_account @anonymized_account @anonymized_account Gdzie jest @anonymized_account . Brudziński jesteś kłamcą i marnym kutasem @anonymized_account, Question: Does the tweet contain cyberbullying (harmful) content?
Output: Yes
The tweet contains Bullying content
New input case for you: Tweet: @anonymized_account Zaraz się obudzi jakiś purysta językowy, że tak się nie mówi. , Question: Is the tweet free of any cyberbullying (harmful) content?
Output: | Yes |
In mathematics, the absolute value of a number is the non-negative value of that number, without regarding its sign. For example, the absolute value of -2 is 2, and the absolute value of 5 is 5. In this task you will be given a list of numbers and you need to return the element with highest absolute value. If a negative and positive element have the same absolute value you should return the positive element. The absolute value for negative numbers can be found by multiplying them by -1. After finding the element with the maximum absolute value you should return the value of that element before you applied the absolute value.
[EX Q]: [ 99.034 -68.072 -16.417 -0.201]
[EX A]: 99.034
[EX Q]: [ 55.151 83.639 -69.798 -14.937 70.713 3.143 40.828 75.77 53.353]
[EX A]: 83.639
[EX Q]: [ 62.237 -58.431 41.947]
[EX A]: | 62.237
|
In this task you will be given a string and you should find the longest substring that is a palindrome. A palindrome is a string that is the same backwards as it is forwards. If the shortest possible palindrome is length 1 you should return the first character.
Example: gocogccocco
Example solution: gocog
Example explanation: The substring 'gocog' is the longest possible substring that is also a palindrome. So this is a good example.
Problem: reerrexrex
| Solution: reer |
In this task, you are given a country name and you need to answer with the government type of the country, as of the year 2015. The following are possible government types that are considered valid answers: Republic, Parliamentary Coprincipality, Federal Republic, Monarchy, Islamic Republic, Constitutional Monarchy, Parlementary Monarchy, Federation.
Ex Input:
Saint Vincent and the Grenadines
Ex Output:
Constitutional Monarchy
Ex Input:
Bhutan
Ex Output:
Monarchy
Ex Input:
Andorra
Ex Output:
| Parliamentary Coprincipality
|
Detailed Instructions: In this task, you will be shown a sentence, and you should determine whether it is overruling or non-overruling. In law, an overruling sentence is a statement that nullifies a previous case decision as a precedent by a constitutionally valid statute or a decision by the same or higher ranking court which establishes a different rule on the point of law involved. Classify your answers into overruling or non-overruling
Q: what does that tell us? . . . if it was jaime castillo and dozer, or hondo and dozer, actually blocking off the route of escape for the possible victims, then they're acting as accomplices as well and they're just as guilty for the murder as though they pulled the trigger at the back patio area. that's accomplice liability.
A: | non-overruling |
Q: We would like you to assess the QUALITY of each of the following argument (discussing Gun Control) and determine if the argument is Valid or Invalid. A valid argument is clearly interpretable and either expresses an argument, or a premise or a conclusion that can be used in an argument for the topic of gun control. An invalid argument is a phrase that cannot be interpreted as an argument or not on the topic of gun control.
First, right after the weeping victims, Moore puts on Heston's "I have only five words for you . . . cold dead hands" statement, making it seem directed at them.
A: | Valid |
Given the task definition and input, reply with output. Given a part of privacy policy text, identify the purpose for which the user information is collected/used. The purpose should be given inside the policy text, answer as 'Not Specified' otherwise
A named third party does do something unspecified with your unspecified personal information for a basic service or feature.
| Basic service/feature |
In this task you will be given a list of integers. A list contains numbers separated by a comma. You need to round every integer to the closest power of 2. A power of 2 is a number in the form '2^n', it is a number that is the result of multiplying by 2 n times. The following are all powers of 2, '2, 4, 8, 16, 32, 64, 128, 256, 512, 1024, 2048, 4096'. If an integer is exactly in equally far from two different powers of 2 then you should output the larger power of 2. The output should be a list of integers that is the result of rounding each integer int the input list to the closest power of 2. The output should include a '[' to denote the start of the output list and ']' to denote the end of the output list.
One example: [16, 205, 171, 2, 9, 317]
Solution is here: [16, 256, 128, 2, 8, 256]
Explanation: Every integer in the input list is rounded to the nearest power of 2. The number 2 and 16 are in the input list and both are a power of 2, therefore rounding to the closest power of 2 returns the same number. This is a good example.
Now, solve this: [84, 633, 3397, 1473, 23, 68, 4, 124, 756, 3539, 4086, 14, 61]
Solution: | [64, 512, 4096, 1024, 16, 64, 4, 128, 512, 4096, 4096, 16, 64] |
Teacher:In this task, you will be presented with a question in Dutch language, and you have to write the person names from the question if present. B denotes the first item of a phrase and an I any non-initial word. Phrase used for the person name - PER. There can be instances with no person name entity, then return 'None'.
Teacher: Now, understand the problem? Solve this instance: Tot dertig jaar geleden besliste een muntstuk over winst of verlies .
Student: | None |
In this task you will be given a list of numbers and you need to find the mean (average) of that list. The mean of a list can be found by summing every number in the list then dividing the result by the size of that list. The output should be rounded to 3 decimal places.
[-84.771, 60.727, 165.566, 27.782, 159.929, 167.451, -64.15]
61.791
[65.486, -51.995, 170.628, -23.998, 83.128, -57.38, 130.737, 214.738]
66.418
[128.007, -8.497]
| 59.755
|
Part 1. Definition
In this task, you are given the name of an Indian food dish. You need to return whether the dish is "non vegetarian" or "vegetarian". Do not answer with any words other than those two.
Part 2. Example
Balu shahi
Answer: vegetarian
Explanation: Balu shahi is a vegetarian dish.
Part 3. Exercise
Adhirasam
Answer: | vegetarian |
Detailed Instructions: The given sentence contains a typo which could be one of the following four types: (1) swapped letters of a word e.g. 'niec' is a typo of the word 'nice'. (2) missing letter in a word e.g. 'nic' is a typo of the word 'nice'. (3) extra letter in a word e.g. 'nicce' is a typo of the word 'nice'. (4) replaced letter in a word e.g 'nicr' is a typo of the word 'nice'. You need to identify the typo in the given sentence. To do this, answer with the word containing the typo.
Q: Snoqwboarder doing a flip while going down the hill.
A: | Snoqwboarder |
Given the task definition and input, reply with output. In this task, you are given an input list. A list contains several comma-separated items written within brackets. You need to return the position of all the alphabetical elements in the given list in order. Assume the position of the 1st element to be 1. Return -1 if no alphabetical element is in the list.
['8079', 'H', '5919', 'H', 'D', '4661', '9575', 'o']
| 2, 4, 5, 8 |
Instructions: You are given a statement written in Hindi. Choose the most logical word from the given 4 options which can be used to replace the <MASK> token in the statement. Output the word from the correct option .
Input: Statement: २०१३ में <MASK> राज्य में नए नगर निगम बनाने के लिए जनसंख्या का मानक सवा लाख से घटाकर एक लाख कर दिया गया था। इसके बाद २७ जनवरी २०१३ को उत्तराखण्ड के तत्कालीन मुख्यमंत्री, विजय बहुगुणा ने रुड़की और रुद्रपुर के साथ-साथ काशीपुर को भी नगर निगम बनाने की घोषणा की। २८ फरवरी २०१३ को इसकी आधिकारिक अधिसूचना जारी की गई, जिसके बाद काशीपुर नगर पालिका का उच्चीकरण करके इसे नगर निगम का दर्जा दिया गया।
Option A: उत्तराखण्ड
Option B: अफगानिस्तान
Option C: जापान
Option D: भारत
Output: | उत्तराखण्ड |
In this task you are expected to write an SQL query that will return the data asked for in the question. An SQL query works by selecting data from a table where certain conditions apply. A table contains columns where every row in that table must have a value for each column. Every table has a primary key that uniquely identifies each row, usually an id. To choose which columns are returned you specify that after the "SELECT" statement. Next, you use a "FROM" statement to specify what tables you want to select the data from. When you specify a table you can rename it with the "AS" statement. You can reference that table by whatever name follows the "AS" statement. If you want to select data from multiple tables you need to use the "JOIN" statement. This will join the tables together by pairing a row in one table with every row in the other table (Cartesian Product). To limit the number of rows returned you should use the "ON" statement. This will only return rows where the condition specified after the statement is true, this is usually an equals operator with primary keys. You can also use the "WHERE" statement to specify that only rows with column values statisfying a certain condition, should be returned. The "GROUP BY" statement will group rows together that have equal column values for whatever columns follows the statement. The "HAVING" statement will return groups that statisfy whatever condition follows the statement. Any column(s) being returned from grouped rows must either be an aggregate function, (AVG, MAX, COUNT, SUM, ...) of a column, or the column(s) that the data was grouped by. To sort the returned data you can use the "ORDER BY" command which will order the data by whatever aggregate function or column follows the statement. The "DESC" statement will sort in descending order and the "ASC" statement will sort in ascending order. Finally, you can use the "LIMIT" statement to return a certain number of rows. When "*" is used in an SQL statement every column is returned. For example, SELECT * FROM table WHERE attribute = 1, will select every column from rows with the attribute column equal to 1.
Q: What are the first and last names of all the employees and how many people report to them?
A: SELECT T2.first_name , T2.last_name , count(T1.reports_to) FROM employees AS T1 JOIN employees AS T2 ON T1.reports_to = T2.id GROUP BY T1.reports_to ORDER BY count(T1.reports_to) DESC LIMIT 1
****
Q: Find the average ranking for each player and their first name.
A: SELECT avg(ranking) , T1.first_name FROM players AS T1 JOIN rankings AS T2 ON T1.player_id = T2.player_id GROUP BY T1.first_name
****
Q: What are the names of tourist attraction that Alison visited but Rosalind did not visit?
A: | SELECT T1.Name FROM Tourist_Attractions AS T1 JOIN VISITORS AS T2 JOIN VISITS AS T3 ON T1.Tourist_Attraction_ID = T3.Tourist_Attraction_ID AND T2.Tourist_ID = T3.Tourist_ID WHERE T2.Tourist_Details = "Alison" EXCEPT SELECT T1.Name FROM Tourist_Attractions AS T1 JOIN VISITORS AS T2 JOIN VISITS AS T3 ON T1.Tourist_Attraction_ID = T3.Tourist_Attraction_ID AND T2.Tourist_ID = T3.Tourist_ID WHERE T2.Tourist_Details = "Rosalind"
****
|
instruction:
We would like you to assess the QUALITY of each of the following argument (discussing Death Penalty) and determine if the argument is Valid or Invalid. A valid argument is clearly interpretable and either expresses an argument, or a premise or a conclusion that can be used in an argument for the topic of death penalty. An invalid argument is a phrase that cannot be interpreted as an argument or not on the topic of death penalty.
question:
No more pain, no more suffering, no more hardship, no more earthly demands, no more constantly uncertaintly, no more worrying, no more problems.
answer:
Invalid
question:
With remarkably few exceptions, neither the media nor public policy makers have required death penalty opponents to support their claims or to define their standards.
answer:
Valid
question:
I'm okay with it as long as the evidence is fool proof .
answer:
| Invalid
|
In this task, you will be given sentences in which you have to recognize the name of the body cells. A cell is a mass of cytoplasm that is bound externally by a cell membrane. Usually microscopic in size, cells are the smallest structural units of living matter and compose all living things. Although there might be several correct answers, you need to write one of them.
Example: HeLa cells were first treated with 250 mug / ml Trail followed by pulse labeling of newly synthesized proteins with [ 35S ] methionine.
Example solution: HeLa cells
Example explanation: HeLa cells are the first immortal human cell line. It should be tagged.
Problem: RT - PCR analysis revealed constitutive expression of the SLAP - 2 gene in bone marrow macrophages .
| Solution: macrophages |
Detailed Instructions: In this task, you will be given sentences in which you have to recognize the name of the body cells. A cell is a mass of cytoplasm that is bound externally by a cell membrane. Usually microscopic in size, cells are the smallest structural units of living matter and compose all living things. Although there might be several correct answers, you need to write one of them.
Q: Multiple phosphotyrosine phosphatase mRNAs are expressed in the human lung fibroblast cell line WI - 38 .
A: | fibroblast |
You are given first 5 messages from a series of message exchanges between 2 persons playing the game of Diplomacy which is an American strategic board game. You need to generate the next message. The message should be generated such that it fits the context seen so far. Avoid the text that is (i) tangent to the context, (ii) repeats the context.
['Heyyy guy', 'Thoughts re: la France?', 'Thinks seem pretty cordial so far. That said, I wouldn’t mind a thorn in his side. What are you thinking?', 'I’m thinking it might be to our advantage to pressure him a bit...rn he’s getting a LOT of builds this turn, and then he’s probably coming straight at us.', 'I can move on Picardy, but only if you move on Belgium. I think Germany is going for him, so now’s your chance to get a slice of France while the getting is good.'] | Looking back at the board and damn, he has left Belgium wide open for you |
In medical studies, the efficacy of medical treatments (called interventions) is evaluated within a group of study participants. You will be given a sentence of a study report in which your task is to list the phrases that describe the intervention(s) of the study. You should list the phrase in the same order that they appear in the text, separated by commas. If no information about the interventions is mentioned, just answer with "not found". Interventions are: a specific drug, surgery, talking therapy, a lifestyle modification, control or placebo treatment. Do not include details, dosages, frequency and duration, intervention mentions that are not in an informative span of text.
--------
Question: In 78 children known to be infected with Ascaris at baseline , the rate of weight gain was 21 per cent greater in children treated with levamisole than in those receiving placebo ( p = .03 ) .
Answer: levamisole, placebo
Question: The upper 95 % CL for the differences in positive cultures between the antibiotics was 4.9 % at days 3-6 , 6.5 % at days 12-16 and 8.5 % at days 26-36 .
Answer: not found
Question: The latter metabolite is not formed in man through the mono-oxygenase pathway of cytochrome P450 .
Answer: | not found
|
Detailed Instructions: In this task, you will be given a list of numbers. The goal is to divide all the numbers in the list by a constant such that the sum of the resulting list is 1. The output should be rounded to 3 decimals.
Q: [193.953, -8.493, 39.402, 135.275, 119.182, -86.212, 241.05, -86.803, 67.504]
A: | [ 0.315 -0.014 0.064 0.22 0.194 -0.14 0.392 -0.141 0.11 ] |
Detailed Instructions: In this task you are expected to write an SQL query that will return the data asked for in the question. An SQL query works by selecting data from a table where certain conditions apply. A table contains columns where every row in that table must have a value for each column. Every table has a primary key that uniquely identifies each row, usually an id. To choose which columns are returned you specify that after the "SELECT" statement. Next, you use a "FROM" statement to specify what tables you want to select the data from. When you specify a table you can rename it with the "AS" statement. You can reference that table by whatever name follows the "AS" statement. If you want to select data from multiple tables you need to use the "JOIN" statement. This will join the tables together by pairing a row in one table with every row in the other table (Cartesian Product). To limit the number of rows returned you should use the "ON" statement. This will only return rows where the condition specified after the statement is true, this is usually an equals operator with primary keys. You can also use the "WHERE" statement to specify that only rows with column values statisfying a certain condition, should be returned. The "GROUP BY" statement will group rows together that have equal column values for whatever columns follows the statement. The "HAVING" statement will return groups that statisfy whatever condition follows the statement. Any column(s) being returned from grouped rows must either be an aggregate function, (AVG, MAX, COUNT, SUM, ...) of a column, or the column(s) that the data was grouped by. To sort the returned data you can use the "ORDER BY" command which will order the data by whatever aggregate function or column follows the statement. The "DESC" statement will sort in descending order and the "ASC" statement will sort in ascending order. Finally, you can use the "LIMIT" statement to return a certain number of rows. When "*" is used in an SQL statement every column is returned. For example, SELECT * FROM table WHERE attribute = 1, will select every column from rows with the attribute column equal to 1.
Problem:What are the names of the teachers and how many courses do they teach?
Solution: | SELECT T2.Name , COUNT(*) FROM course_arrange AS T1 JOIN teacher AS T2 ON T1.Teacher_ID = T2.Teacher_ID GROUP BY T2.Name |
TASK DEFINITION: You are given first 5 messages from a series of message exchanges between 2 persons playing the game of Diplomacy which is an American strategic board game. You need to generate the next message. The message should be generated such that it fits the context seen so far. Avoid the text that is (i) tangent to the context, (ii) repeats the context.
PROBLEM: ['Greetings My Good Frenchman! \n\nHow are your opening moves looking? I would love a solid Russo-French relationship so I’ll start off with some intel for you: Italy is headed west for you', 'Hi there,\n\nHow is that going to work? Austria vs turkey without Italy?', "Ha I honestly don't know, just trying to tip you off", "How'd the first turn go for you? I was hoping to make gains in Gal and BLA but was bounced out. Do you think E/G are working against you?", 'I have expected a bounce in Pie because you and another power told me so']
SOLUTION: Looks like a conspiracy here against me
PROBLEM: ['Hi Italy, I hope we can reach a mutually beneficial agreement on what we want to do in these opening moves', 'Hi Austria! Yes definitely willing to work together', 'Did you have anything in mind?', "Yes, I'd like to develop to the Balkans, keeping Turkey busy, which would allow a Lepanto opening from your side", 'Ok! That works for me']
SOLUTION: Have you been able to gather anything from Russia yet?
PROBLEM: ['Hello Russia. Have you worked out what you’re doing with turkey and Austria yet? I’m thinking of going anti Germany but want to see how we align in the north first.', 'I sent Turkey a message but still waiting on a reply. I wanted to go anti-Germany too if you want to split the population centers? But if I don’t hear back from Turkey I may have to fortify my South flank and enter the Balkan’s even though I don’t want to.', 'I moving to pressureGermany but I could use assistance on your end. Willing to share any gains that could result.', 'Yikes. You have some Turkish trouble. I’ll plan on moving into helgoland bight', 'Yea, that’s always annoying playing as Russia. Trying to get AH to help out but I have to move one of my troops back West away from pressuring Germany. Oh well.']
SOLUTION: | That’s a shame. Let’s reassess after you handle your problems in the east.
|
In this task, you are given an input list. A list contains several comma-separated items written within brackets. You need to return the position of all the alphabetical elements in the given list in order. Assume the position of the 1st element to be 1. Return -1 if no alphabetical element is in the list.
['5327', 'I', '5609', '1919', '8523', 'I', 'K', '2459', 'd', '3613', '1657', '995', '899', '2571', 'R', 'D', 'n', '9253', 'j', '7355', '8187', '1079', 'M', 'C', 'F', '9321', '3397', 'p', 'e', 'A', 'O', 'f', 'n', '775', 'l', 'b', 'a', '6171']
2, 6, 7, 9, 15, 16, 17, 19, 23, 24, 25, 28, 29, 30, 31, 32, 33, 35, 36, 37
['9549', '6143', 'K', 'X', 'r', 'e', '6045', '757', '8865', 'q', 'Y', 'b', '8601', 'E', 'u', '6665', '1501', '8183', 'b', 'O']
3, 4, 5, 6, 10, 11, 12, 14, 15, 19, 20
['H', 'c', '3671', 'K', 'Y', 'O', '7219', 'T', '2163', 'P', '3001', 'r', 'O', 'X', '8443', '7899', 'G', 'h', '5385', 'Y', '4231', 'w', 'O']
| 1, 2, 4, 5, 6, 8, 10, 12, 13, 14, 17, 18, 20, 22, 23
|
Part 1. Definition
In this task, you are given a string with unique characters in it and you need to return the character from the string which has the maximum ASCII value. ASCII stands for American Standard Code For Information Interchange and It assigns a unique number to each character. The characters [a - z] have an ASCII range of 97-122 and [A-Z] have an ASCII range of 65-90 respectively.
Part 2. Example
aBxyZde
Answer: y
Explanation: y has the maximum ascii value in the given string.
Part 3. Exercise
xcvzVreWyQEqDwpkAGjb
Answer: | z |
Two analogies that relate objects to the associated rooms is given in the form "A : B. C : ?". "A : B" relates object A to room B. Your task is to replace the question mark (?) with the appropriate room for the given object C, following the "A : B" relation.
Q: desk : office. toolbox : ?
A: garage
****
Q: crib : bedroom. shelf : ?
A: kitchen
****
Q: car : driveway. toolbox : ?
A: | garage
****
|
Given a hotel review and the corresponding polarity of review (i.e., Negative or Positive) identify if the polarity is correct. Write 'true' if it's correct, 'false' otherwise.
Example: Review: I stayed at the Hilton Chicago for my cousins wedding. The service was impeccable. Not only was the staff attentive, they were respectful and careful not to interrupt the guests or make themselves known when serving dinner. I had the chicken wellington and it was to die for! The chicken was perfect and moist but the pastry crust was flaky and crispy. They even had Pakistani dinner options for some of the guests. The amenities were great, and after an open bar the night before, the Mimosas and brunch buffet couldn't have been better! I would love to have my wedding there.
Polarity: Positive
Example solution: true
Example explanation: Review writer likes the hotel. There are strong positive words like 'impeccable' and 'great'. Therefore it is true as the polarity mentioned.
Problem: Review: I stayed at the Chicago Fairmont for four nights for a conference. My fiance' accompanied me. When we checked in, we were given a room with two full size beds despite the fact that our reservation was for one king size bed. So instead of relaxing on the large luxurious bed we had imagined, we were forced to either sleep in separate beds like Ward and June Cleaver or either cuddle up on a small full size like two college kids in a fraternity house! We discovered that the coffee maker wasn't working and called down to the desk to have someone look at it, and waited two and half hours. We had issues with the plumbing, including extremely slow hot water tap in the bathtub which took 45 minutes to fill. The toilet stopped working twice. We returned one afternoon from the art museum to find the maid in our room, sitting on the bed, watching the tv and talking on her cell phone. They bellman were rude, and wouldn't let my fiance unload our own car which was packed with some of his very expensive camera equipment. There were errors on our bill. Last but not least, we saw a ROACH in the drawers. Alive. The restaurant downstairs was decent, and the location is fairly good since my conference was in the Hyatt next door but for the price you can find someplace better. I will never ever stay here again under any circumstances.
Polarity: Positive
| Solution: false |
In this task you will be given a list of numbers and you should remove all duplicates in the list. If every number is repeated in the list an empty list should be returned. Your list should be numbers inside brackets, just like the given list.
[7, 5, 3, 7, 6, 5]
[3, 6]
[6, 0, 5, 3, 5, 6, 5, 3, 7, 2]
[0, 7, 2]
[4, 1, 0, 2, 4, 2, 5]
| [1, 0, 5]
|
In this task, you are given a country name, and you need to return the country's surface area in terms of square kilometers. Up to two decimal places are allowed in your answer.
Q: Bolivia
A: | 1098581.00 |
Subsets and Splits