text
stringlengths
25
141k
lowercased
stringlengths
25
141k
In insurance claims, a total loss or write-off is a situation where the lost value, repair cost or. If the insured item is, say, a car or a house, the policy will normally give it a "market value" which may be less than. settled; so the insurer may be relieved not to have the insured item surrogated to him, as in Asfar v Blundell . Feb 4, 2015. Collision Insurance: This covers repairs to your own car when you hit another. you will be responsible for more of the cost if you file a claim. Dec 24, 2017. If you're in a large or particularly destructive car accident, the aftermath will probably involve lots of rounds with insurance agents, claims. but you’d pay less out of pocket for a claim. To put it simply, a binder is a temporary insurance policy. It can come in handy when you need proof of. But as well as safety concerns, drivers have been warned that they may not be paid for any insurance claims if they ignore the recall, Finder reports. “If you are. Nov 3, 2016. Grand Theft Auto V. On average, the insurance claim to return your vehicle is about 1% of the purchase price (if it would be purchased from a. Information Center | Car Appraisals & Claims – Frequently Asked Questions. How much can you. FIRST PARTY V. THIRD PARTY CLAIMS. The insurance company sent me a check in the mail for Diminished Value, do I cash it? No, it's not. Jan 11, 2009. For example, in Ray v. At the time of the collision, the insured's car had a market value of approximately $7,100, and after. ACV basis and later claim the RCV benefits by satisfying the conditions of coverage (e.g., repair or. Free Consultation – Cincinnati insurance claims: settlements and trials with this insurance company: premises liability and car/truck accident claims. Zen Design (insurance company required to defendant lawsuit); Cincinnati Insurance v. Comprehensive insurance covers your car if it's damaged by hail, storms, falling tree limbs or other. A claim is a request for your insurer to pay for your losses. under the heading ‘I feel like a criminal’, reported how one lady’s premium. Nov 13, 2014. Filing a car insurance claim right after an accident actually might not be in. the windshield when i parked. its brand new Honda CR-V EX 2016. ACCORDING to recent reports, the cost of insuring a car dropped. asked. Will my policy pay for a rental car while my car is being repaired? If so, how much ? Remember, each state has its own laws governing the claims process. An insurance company can also estimate total claim size using vehicles. Vehicle Age (V) Equals 1 if the insured vehicle is seven to nine years old (in relation.
in insurance claims, a total loss or write-off is a situation where the lost value, repair cost or. if the insured item is, say, a car or a house, the policy will normally give it a "market value" which may be less than. settled; so the insurer may be relieved not to have the insured item surrogated to him, as in asfar v blundell . feb 4, 2015. collision insurance: this covers repairs to your own car when you hit another. you will be responsible for more of the cost if you file a claim. dec 24, 2017. if you're in a large or particularly destructive car accident, the aftermath will probably involve lots of rounds with insurance agents, claims. but you’d pay less out of pocket for a claim. to put it simply, a binder is a temporary insurance policy. it can come in handy when you need proof of. but as well as safety concerns, drivers have been warned that they may not be paid for any insurance claims if they ignore the recall, finder reports. “if you are. nov 3, 2016. grand theft auto v. on average, the insurance claim to return your vehicle is about 1% of the purchase price (if it would be purchased from a. information center | car appraisals & claims – frequently asked questions. how much can you. first party v. third party claims. the insurance company sent me a check in the mail for diminished value, do i cash it? no, it's not. jan 11, 2009. for example, in ray v. at the time of the collision, the insured's car had a market value of approximately $7,100, and after. acv basis and later claim the rcv benefits by satisfying the conditions of coverage (e.g., repair or. free consultation – cincinnati insurance claims: settlements and trials with this insurance company: premises liability and car/truck accident claims. zen design (insurance company required to defendant lawsuit); cincinnati insurance v. comprehensive insurance covers your car if it's damaged by hail, storms, falling tree limbs or other. a claim is a request for your insurer to pay for your losses. under the heading ‘i feel like a criminal’, reported how one lady’s premium. nov 13, 2014. filing a car insurance claim right after an accident actually might not be in. the windshield when i parked. its brand new honda cr-v ex 2016. according to recent reports, the cost of insuring a car dropped. asked. will my policy pay for a rental car while my car is being repaired? if so, how much ? remember, each state has its own laws governing the claims process. an insurance company can also estimate total claim size using vehicles. vehicle age (v) equals 1 if the insured vehicle is seven to nine years old (in relation.
Despite life’s many twists and turns, Colleen Acosta used her determination and passion for the sport to help her grow. Through hard work and sacrifice, she has worked her way through the ranks in the equestrian industry. With grand prix dreams, Colleen went from riding whatever horse was thrown at her to running her own facility and seeing her dreams unfold thanks to her never-ending dedication to the sport. Like many equestrians, Colleen began riding at a young age with her mother, a trainer. She bought her first pony, Sprinkle, for $100 from a sale yard. “He was as mean as he could be,” Colleen laughed, “but he taught me so much.” As she grew up, she had many opportunities to ride the sale horses that came in and out of her mother’s barn. “I was never as fortunate to have the horses I have now in my barn; I didn’t have horses like that growing up at all,” she said. Colleen began showing in walk/trot at the age of 5 and continued showing in the local arenas, eventually moving up to A shows. After graduating from high school, Colleen began selling horse trailers to make money and continued to ride, dreaming of the day she’d ride in the grand prix. “I idolized every single person who was competing at that level,” Colleen recalled. “That was all I ever wanted, so I rode everything I could.” It was at that point in her life when Katie Young of Coriander Farm in Jacksonville, Florida, took Colleen under her wing. To this day Colleen attributes her further riding-skill development to her time with Katie. “I’m a very ambitious person,” said Colleen, as she spoke of all of the hard work she put in during her formative years as a rider. “I am where I am just because I’ve been so hungry for it.” That hunger, and a marriage of now 17 years, took the young couple to Texas when her husband, Tracy Acosta, reenlisted in the Navy to help better support their small family. There, she began working for Jim and Joan Henson of Foxglen Farms for a few years before moving on to work with Matt Cyphert for five years. After many years of building up her resume, the opportunity came along for Colleen to run Showtime Farms in Southlake, Texas, owned by Dale Binder. “That step was quite scary. I’m a firm believer in hard work and doing things correctly and fairly, and I think everything comes back 10 times more if you do that,” said Colleen. Five years later, the decision has paid off and Colleen is grateful to Dale for the opportunity. After moving to Showtime Farms, Colleen acquired several talented grand prix horses, including a special horse Diamond who was purchased for a student to show in the 1.30m classes. After an incident that bruised the rider’s confidence, Colleen encouraged them to allow her to show Diamond and the father of the rider suggested she try him in the grand prix. “I still tell him to this day that I thought he was crazy,” Colleen laughed. “I knew the horse was willing, so I gave it a shot and he ended up winning his first two grand prix.” Diamond continued to impress, ribboning in many classes winning two weeks in a row at Brownland and once at Gulf Port. Colleen, competing in Texas, is a firm believer in working hard. While Colleen is striving toward marking off some bucket-list items such as riding in Europe, she appreciates the place she is now in her career. Colleen is quick to acknowledge that the strength and support of her hardworking team at Showtime Farms has definitely helped her in achieving her goals. Looking back on her past and remembering the hard times along the way, she has one piece of advice to her younger self and other young riders out there.
despite life’s many twists and turns, colleen acosta used her determination and passion for the sport to help her grow. through hard work and sacrifice, she has worked her way through the ranks in the equestrian industry. with grand prix dreams, colleen went from riding whatever horse was thrown at her to running her own facility and seeing her dreams unfold thanks to her never-ending dedication to the sport. like many equestrians, colleen began riding at a young age with her mother, a trainer. she bought her first pony, sprinkle, for $100 from a sale yard. “he was as mean as he could be,” colleen laughed, “but he taught me so much.” as she grew up, she had many opportunities to ride the sale horses that came in and out of her mother’s barn. “i was never as fortunate to have the horses i have now in my barn; i didn’t have horses like that growing up at all,” she said. colleen began showing in walk/trot at the age of 5 and continued showing in the local arenas, eventually moving up to a shows. after graduating from high school, colleen began selling horse trailers to make money and continued to ride, dreaming of the day she’d ride in the grand prix. “i idolized every single person who was competing at that level,” colleen recalled. “that was all i ever wanted, so i rode everything i could.” it was at that point in her life when katie young of coriander farm in jacksonville, florida, took colleen under her wing. to this day colleen attributes her further riding-skill development to her time with katie. “i’m a very ambitious person,” said colleen, as she spoke of all of the hard work she put in during her formative years as a rider. “i am where i am just because i’ve been so hungry for it.” that hunger, and a marriage of now 17 years, took the young couple to texas when her husband, tracy acosta, reenlisted in the navy to help better support their small family. there, she began working for jim and joan henson of foxglen farms for a few years before moving on to work with matt cyphert for five years. after many years of building up her resume, the opportunity came along for colleen to run showtime farms in southlake, texas, owned by dale binder. “that step was quite scary. i’m a firm believer in hard work and doing things correctly and fairly, and i think everything comes back 10 times more if you do that,” said colleen. five years later, the decision has paid off and colleen is grateful to dale for the opportunity. after moving to showtime farms, colleen acquired several talented grand prix horses, including a special horse diamond who was purchased for a student to show in the 1.30m classes. after an incident that bruised the rider’s confidence, colleen encouraged them to allow her to show diamond and the father of the rider suggested she try him in the grand prix. “i still tell him to this day that i thought he was crazy,” colleen laughed. “i knew the horse was willing, so i gave it a shot and he ended up winning his first two grand prix.” diamond continued to impress, ribboning in many classes winning two weeks in a row at brownland and once at gulf port. colleen, competing in texas, is a firm believer in working hard. while colleen is striving toward marking off some bucket-list items such as riding in europe, she appreciates the place she is now in her career. colleen is quick to acknowledge that the strength and support of her hardworking team at showtime farms has definitely helped her in achieving her goals. looking back on her past and remembering the hard times along the way, she has one piece of advice to her younger self and other young riders out there.
Triumph Performance – from Warm to Wild! Mid Life Cycles has joined forces with renowned engineer Andrew Hallam of Hallam Racing to develop a range of performance packages for late-model Triumph Bonnevilles, Thruxtons and Scramblers and their Triumph America and Speedmaster cousins. The performance mods apply to the 865cc Triumph twins in both EFI and earlier carburettor form and to the 180 and 270-degree cam engines. Developed and dyno-tested by Hallam Racing and fitted in the Mid Life Cycles workshop by experienced Triumph technicians Charlie Hallam (pictured) and Nic Sutcliffe, the performance modifications range from a relatively straight-forward camshaft upgrade through a series of camshaft and intake-related improvements to the full-house Hallam Racing mods perfected during the development of Triumph’s own Salt Racer engine. At last count, Mid Life Cycles had modified more than 15 customer bikes with several more in the workshop undergoing major performance improvements. The Stage 1 Cam Upgrade takes the soft-tuned Bonnie / Thruxtons from a dyno-measured 36 horsepower at the rear wheel to 60-plus horsepower – that’s around a 70 percent improvement for an outlay of about $1500 ($1600 for the Scrambler). This has proved more than enough for many Mid Life Cycles customers, who describe the Stage 1 kit as “what Triumph should have produced in the first place”. Most bikes also receive suspension improvements over standard to make the trad-Triumphs handle much better than stock. Recently, several Mid Life Cycles customers have opted for the Stage 3 Cam Upgrade kit, which utilises a more aggressive inlet cam as used on Triumph’s Salt Racer, a modified exhaust cam and a series of other tweaks, plus fitting and dyno-tuning a Power Commander. All of this work comfortably doubles the horsepower of the standard bike and there’s a big lift in torque all the way from 48 ft/lb at 3200rpm through to a peak of 55 ft/lb at 6200rpm, tailing off only a little to 50 ft/lb at 8000 rpm. Compare this to the standard (Bonneville / Thruxton) engine’s 40 ft/lb at 3200rpm, dropping to only 32 ft/lb by 6000rpm. And if this isn’t enough, Hallam Racing and Mid Life Cycles take the Stage 3 Cam Upgrade kit as a baseline and offer a series of further performance mods tested and proven in road and race applications. These modifications focus on improved breathing and include porting and matching the manifolds, bigger valves, a small increase in compression and other tuning tricks to get even more from the Triumph twin. And we’ve only lifted the head – there’s still the option of big-bore kits and other goodies! The next step for the Hallam Racing-Mid Life Cycles combo will be performance upgrades for the new 1200-engined Triumphs. Watch this space!
triumph performance – from warm to wild! mid life cycles has joined forces with renowned engineer andrew hallam of hallam racing to develop a range of performance packages for late-model triumph bonnevilles, thruxtons and scramblers and their triumph america and speedmaster cousins. the performance mods apply to the 865cc triumph twins in both efi and earlier carburettor form and to the 180 and 270-degree cam engines. developed and dyno-tested by hallam racing and fitted in the mid life cycles workshop by experienced triumph technicians charlie hallam (pictured) and nic sutcliffe, the performance modifications range from a relatively straight-forward camshaft upgrade through a series of camshaft and intake-related improvements to the full-house hallam racing mods perfected during the development of triumph’s own salt racer engine. at last count, mid life cycles had modified more than 15 customer bikes with several more in the workshop undergoing major performance improvements. the stage 1 cam upgrade takes the soft-tuned bonnie / thruxtons from a dyno-measured 36 horsepower at the rear wheel to 60-plus horsepower – that’s around a 70 percent improvement for an outlay of about $1500 ($1600 for the scrambler). this has proved more than enough for many mid life cycles customers, who describe the stage 1 kit as “what triumph should have produced in the first place”. most bikes also receive suspension improvements over standard to make the trad-triumphs handle much better than stock. recently, several mid life cycles customers have opted for the stage 3 cam upgrade kit, which utilises a more aggressive inlet cam as used on triumph’s salt racer, a modified exhaust cam and a series of other tweaks, plus fitting and dyno-tuning a power commander. all of this work comfortably doubles the horsepower of the standard bike and there’s a big lift in torque all the way from 48 ft/lb at 3200rpm through to a peak of 55 ft/lb at 6200rpm, tailing off only a little to 50 ft/lb at 8000 rpm. compare this to the standard (bonneville / thruxton) engine’s 40 ft/lb at 3200rpm, dropping to only 32 ft/lb by 6000rpm. and if this isn’t enough, hallam racing and mid life cycles take the stage 3 cam upgrade kit as a baseline and offer a series of further performance mods tested and proven in road and race applications. these modifications focus on improved breathing and include porting and matching the manifolds, bigger valves, a small increase in compression and other tuning tricks to get even more from the triumph twin. and we’ve only lifted the head – there’s still the option of big-bore kits and other goodies! the next step for the hallam racing-mid life cycles combo will be performance upgrades for the new 1200-engined triumphs. watch this space!
You might have been told to use a salt water rinse for a number of reasons. Sometimes it’s used for sore gums, a scratchy throat or after a dental treatment. While it doesn’t take the place of your regular oral hygiene, there are some benefits to using a salt water rinse. Before you start rinsing, read this helpful guide to salt water rinses. A long time ago, salt was used by the Egyptians for therapeutic treatments. There’s evidence that suggests they used it as early as 1600 B.C. as an anti-infective precaution. Then, the Greeks were also known for utilizing the healing benefits of salt as well. Besides being a common additive to food, salt increases your mouth’s pH levels. This, in turn, creates an alkaline environment that’s difficult for bacteria to live in. Bacteria naturally desire an acidic home, so rinsing with this alkaline mixture makes it more difficult for the bacteria to thrive. Salt also promotes healing which is why most dentists recommend its use for 24 hours after surgery. This isotonic solution has the same minerals that our bodies do, so it’s completely natural. In addition, it won’t irritate the membranes of your mouth like a commercial mouthwash might. • Put a half teaspoon of salt into your cup of lukewarm water. • Rinse your mouth every few hours for the first couple days after surgery. • After that, feel free to use it less often. Remember, salt water rinses are not designed for everyday use, but as a supplement to your normal oral hygiene. What’s most important is that you are brushing and flossing each day. If you have questions about the practical application of salt water rinses, it’s time to speak with your Miami Beach dentists about the benefits. Please give our office a call at (305) 535-3113 to schedule your next appointment.
you might have been told to use a salt water rinse for a number of reasons. sometimes it’s used for sore gums, a scratchy throat or after a dental treatment. while it doesn’t take the place of your regular oral hygiene, there are some benefits to using a salt water rinse. before you start rinsing, read this helpful guide to salt water rinses. a long time ago, salt was used by the egyptians for therapeutic treatments. there’s evidence that suggests they used it as early as 1600 b.c. as an anti-infective precaution. then, the greeks were also known for utilizing the healing benefits of salt as well. besides being a common additive to food, salt increases your mouth’s ph levels. this, in turn, creates an alkaline environment that’s difficult for bacteria to live in. bacteria naturally desire an acidic home, so rinsing with this alkaline mixture makes it more difficult for the bacteria to thrive. salt also promotes healing which is why most dentists recommend its use for 24 hours after surgery. this isotonic solution has the same minerals that our bodies do, so it’s completely natural. in addition, it won’t irritate the membranes of your mouth like a commercial mouthwash might. • put a half teaspoon of salt into your cup of lukewarm water. • rinse your mouth every few hours for the first couple days after surgery. • after that, feel free to use it less often. remember, salt water rinses are not designed for everyday use, but as a supplement to your normal oral hygiene. what’s most important is that you are brushing and flossing each day. if you have questions about the practical application of salt water rinses, it’s time to speak with your miami beach dentists about the benefits. please give our office a call at (305) 535-3113 to schedule your next appointment.
The strongest storm door in the industry is a Keystone Doors Storm Door. Storm doors of lesser quality can dent, warp, hang crooked, and slam shut. Our Storm Doors won’t do any of those things because they are engineered with innovative features to make them stronger and more durable for everyday use. Your Keystone Storm Door will outlast the others, long into the future, because of these features. Keystone window offers a wide variety of storm door styles and etched glass. We even offer you double door configurations. Styles include full-glass, half-glass, and self-storing storm doors. We use safety glass in all our doors and use heavy duty aluminum screens that put the competition to shame. Heliarc-Welded Corners are the foundation of every StormWeld™ storm door. Unlike conventional doors with screw-type corners, StormWeld™ corners are the strongest spots on the storm door, giving you maximum strength and durability. Our Exclusive Interlocking Hinge System is a “guaranteed not to fail”, four-hinge tubular design which interlocks into the door frame. It eliminates any tendency of the storm door to pull away from the frame, which traditional hinges don’t prevent. Bronze bushings, held in place with heavy steel pins, provide extra durability. StormWeld’s Brush-Type, Adjustable-Bottom Weather Seal is similar to the type of weather seal found on many commercial storm doors. With its nonshrink design, it won’t bind, twist or tear as most traditional vinyl sweeps do. It costs us a little more, but it’s worth it! StormWeld’s Adjustable Hydraulic Closer will provide you with many years of smooth, non-jarring closing action. Our Auto Hold Option is great for those days when you’re carrying groceries in or moving something out and don’t have an extra body available to hold the storm door for you! Durable, Lockable Handles are a standard feature with all StormWeld storm doors. We also offer a variety of optional handle styles for a customized look. 17 Color Choices are available using the most durable color-coating system in the United States. It will keep your door looking better longer than any other finish.
the strongest storm door in the industry is a keystone doors storm door. storm doors of lesser quality can dent, warp, hang crooked, and slam shut. our storm doors won’t do any of those things because they are engineered with innovative features to make them stronger and more durable for everyday use. your keystone storm door will outlast the others, long into the future, because of these features. keystone window offers a wide variety of storm door styles and etched glass. we even offer you double door configurations. styles include full-glass, half-glass, and self-storing storm doors. we use safety glass in all our doors and use heavy duty aluminum screens that put the competition to shame. heliarc-welded corners are the foundation of every stormweld™ storm door. unlike conventional doors with screw-type corners, stormweld™ corners are the strongest spots on the storm door, giving you maximum strength and durability. our exclusive interlocking hinge system is a “guaranteed not to fail”, four-hinge tubular design which interlocks into the door frame. it eliminates any tendency of the storm door to pull away from the frame, which traditional hinges don’t prevent. bronze bushings, held in place with heavy steel pins, provide extra durability. stormweld’s brush-type, adjustable-bottom weather seal is similar to the type of weather seal found on many commercial storm doors. with its nonshrink design, it won’t bind, twist or tear as most traditional vinyl sweeps do. it costs us a little more, but it’s worth it! stormweld’s adjustable hydraulic closer will provide you with many years of smooth, non-jarring closing action. our auto hold option is great for those days when you’re carrying groceries in or moving something out and don’t have an extra body available to hold the storm door for you! durable, lockable handles are a standard feature with all stormweld storm doors. we also offer a variety of optional handle styles for a customized look. 17 color choices are available using the most durable color-coating system in the united states. it will keep your door looking better longer than any other finish.
From Idea to Bookshelf | Kid Reporters' Notebook | Scholastic Inc. Teresa gets writing tips from author Julie C. Dao at Smith Middle School in Chapel Hill, North Carolina. Julie C. Dao made her literary debut with Forest of a Thousand Lanterns (Philomel Books, 2017). The fantasy novel for young people, which is the first of a two-part series, tells the story of an 18-year-old peasant girl in ancient Asia named Xifeng. Her destiny is to become Empress of Feng Lu, but at a great price. Dao, who lives in New England, is Vietnamese-American. She recently spoke about her writing career with students at Smith Middle School in Chapel Hill, North Carolina. Dao explained that she “word-vomited” the first draft of her novel into an online document. The draft was 350 pages long before she revised it. Dao advised writing a synopsis—or summary—before starting on a book. She then makes a chapter online, which helps her with the first draft. “Be sure to get eyeballs on it, too,” Dao suggested. When working on a book, it’s important to get advice from others on what does and doesn’t work. Dao then explained the process of publication. After much effort, she found a literary agent who was willing to represent the book. The agent connected her with an editor at a publishing house. Both agent and editor made suggestions for revising the novel before it was ready for publication. Where do you get inspiration for your books? My inspiration always comes from fairy tales, which I loved as a little girl. For Forest of a Thousand Lanterns, I decided to do a retelling of Snow White. Snow White was never my favorite princess. I wanted to change her character in a way that I would like to see her. I also set the novel in an Asian fantasy world because I wanted to have more characters who look like me. I started when I was 8 or 9 years old because I loved reading so much. I loved being able to fall through the pages into a magical world. I thought, “Hey, maybe I could do this, too,” and wrote my first book when I was 9. What was the biggest challenge on your road to publication? I had a really hard time getting people who were interested in what I had to write, which was about an Asian heroine. It was hard finding someone to represent me [an agent]. I think it took about seven or eight years. It was the longest part of my journey. Once that started, things began to snowball. No matter where a writer is on their journey, if there’s a hard time, they should know that they should keep going and, hopefully, it will be a little bit easier in the future. Why did you choose fantasy? I love fantasy. It’s the one genre I read a lot. I wanted to write it myself. I just love being able to escape. It feels like walking through a door and closing it behind you, and you’re in Narnia, Hogwarts, or Middle-earth from Lord of the Rings. I’ve always liked being able to go off somewhere by myself and explore. That was the mindset I brought to reading books. With writing, I like to joke that you’re the god of your own little world, and you get to decide what happens to everyone. You have a lot of power, and it’s fun. It’s just fun. I can’t not write. It’s something that I’ve always done because it takes stress away from me. I feel like I’m relieving my stress and escaping from the world when I sit down with my own characters. I’ve always wanted to have people who would read my books and find in them a good story. It’s very rewarding to have readers. What is your advice for future authors out there? Keep writing and reading as much as you can. The only reason that I got better at writing and finally got published is that I wrote a lot. I don’t think anyone is born a good writer. People are born liking to write a lot. Because they like it, they want to work on it. When you like something, you want to spend a lot more time on it. The more time you spend on it, the better you get. Writing as much as you can is super important. Kingdom of the Blazing Phoenix, the second book in Dao’s fantasy series, was released in November.
from idea to bookshelf | kid reporters' notebook | scholastic inc. teresa gets writing tips from author julie c. dao at smith middle school in chapel hill, north carolina. julie c. dao made her literary debut with forest of a thousand lanterns (philomel books, 2017). the fantasy novel for young people, which is the first of a two-part series, tells the story of an 18-year-old peasant girl in ancient asia named xifeng. her destiny is to become empress of feng lu, but at a great price. dao, who lives in new england, is vietnamese-american. she recently spoke about her writing career with students at smith middle school in chapel hill, north carolina. dao explained that she “word-vomited” the first draft of her novel into an online document. the draft was 350 pages long before she revised it. dao advised writing a synopsis—or summary—before starting on a book. she then makes a chapter online, which helps her with the first draft. “be sure to get eyeballs on it, too,” dao suggested. when working on a book, it’s important to get advice from others on what does and doesn’t work. dao then explained the process of publication. after much effort, she found a literary agent who was willing to represent the book. the agent connected her with an editor at a publishing house. both agent and editor made suggestions for revising the novel before it was ready for publication. where do you get inspiration for your books? my inspiration always comes from fairy tales, which i loved as a little girl. for forest of a thousand lanterns, i decided to do a retelling of snow white. snow white was never my favorite princess. i wanted to change her character in a way that i would like to see her. i also set the novel in an asian fantasy world because i wanted to have more characters who look like me. i started when i was 8 or 9 years old because i loved reading so much. i loved being able to fall through the pages into a magical world. i thought, “hey, maybe i could do this, too,” and wrote my first book when i was 9. what was the biggest challenge on your road to publication? i had a really hard time getting people who were interested in what i had to write, which was about an asian heroine. it was hard finding someone to represent me [an agent]. i think it took about seven or eight years. it was the longest part of my journey. once that started, things began to snowball. no matter where a writer is on their journey, if there’s a hard time, they should know that they should keep going and, hopefully, it will be a little bit easier in the future. why did you choose fantasy? i love fantasy. it’s the one genre i read a lot. i wanted to write it myself. i just love being able to escape. it feels like walking through a door and closing it behind you, and you’re in narnia, hogwarts, or middle-earth from lord of the rings. i’ve always liked being able to go off somewhere by myself and explore. that was the mindset i brought to reading books. with writing, i like to joke that you’re the god of your own little world, and you get to decide what happens to everyone. you have a lot of power, and it’s fun. it’s just fun. i can’t not write. it’s something that i’ve always done because it takes stress away from me. i feel like i’m relieving my stress and escaping from the world when i sit down with my own characters. i’ve always wanted to have people who would read my books and find in them a good story. it’s very rewarding to have readers. what is your advice for future authors out there? keep writing and reading as much as you can. the only reason that i got better at writing and finally got published is that i wrote a lot. i don’t think anyone is born a good writer. people are born liking to write a lot. because they like it, they want to work on it. when you like something, you want to spend a lot more time on it. the more time you spend on it, the better you get. writing as much as you can is super important. kingdom of the blazing phoenix, the second book in dao’s fantasy series, was released in november.
When creating this film, we were highly influenced by directors, Akira Kurosawa and Sergio Leone. We are both huge fans of Kurosawa’s framing and composition, and his dramatic use of lighting. Sergio Leone’s famous western films such as Once upon a Time in the West, and The Good, the Bad, and the Ugly also made an impact for creating our story. We have incorporated their techniques to enhance the editing and layout for our film. Since we are two international students from different cultures, it was challenging to make a western film feel authentic. However, even though we come from different cultures, we found common ground that helped us push our story. We are both foreigners who felt like strangers at one point in our lives. In correlation to this, our story portrays a character that was once a stranger, and we hope that the audience can relate and appreciate him. It is a very exciting opportunity to create a short film and have full control of the creative process. Our short starts at a slow pace with a simple conflict. As the story progresses the tone becomes more aggressive and intense. The climax delivers an epic fight and the resolution gives the audience a twist. We also utilize some comic reliefs to contrast the intensity of the story. The characters and the set consist of realistic shading, however we are staying true to our stylized concept art. The animation will be realistic due to our use of motion capture.
when creating this film, we were highly influenced by directors, akira kurosawa and sergio leone. we are both huge fans of kurosawa’s framing and composition, and his dramatic use of lighting. sergio leone’s famous western films such as once upon a time in the west, and the good, the bad, and the ugly also made an impact for creating our story. we have incorporated their techniques to enhance the editing and layout for our film. since we are two international students from different cultures, it was challenging to make a western film feel authentic. however, even though we come from different cultures, we found common ground that helped us push our story. we are both foreigners who felt like strangers at one point in our lives. in correlation to this, our story portrays a character that was once a stranger, and we hope that the audience can relate and appreciate him. it is a very exciting opportunity to create a short film and have full control of the creative process. our short starts at a slow pace with a simple conflict. as the story progresses the tone becomes more aggressive and intense. the climax delivers an epic fight and the resolution gives the audience a twist. we also utilize some comic reliefs to contrast the intensity of the story. the characters and the set consist of realistic shading, however we are staying true to our stylized concept art. the animation will be realistic due to our use of motion capture.
Bluegrass on Mother’s Day…what could be better? Sunday’s weather is looking cool and sunny! -Elli will teach an easy, gentle yoga class in the barn. FOOD! Served from 1:30pm – until we run out! -We’ll be serving plates for $10.00 each, which will include a hefty serving of Swedish meatballs (made with Sandy’s grass-fed beef, of course), a baked potato, green beans, a roll, and a dessert of your choice (brownie or apple crisp). Each item can also be bought individually. It should be a beautiful, fun afternoon, and we hope to see you there! If you have any questions, please feel free to leave a comment here, leave a comment on Facebook (friend Capon Crossing!!), or call us at 304-874-3462.
bluegrass on mother’s day…what could be better? sunday’s weather is looking cool and sunny! -elli will teach an easy, gentle yoga class in the barn. food! served from 1:30pm – until we run out! -we’ll be serving plates for $10.00 each, which will include a hefty serving of swedish meatballs (made with sandy’s grass-fed beef, of course), a baked potato, green beans, a roll, and a dessert of your choice (brownie or apple crisp). each item can also be bought individually. it should be a beautiful, fun afternoon, and we hope to see you there! if you have any questions, please feel free to leave a comment here, leave a comment on facebook (friend capon crossing!!), or call us at 304-874-3462.
Methocel F50 is a variety of methylcellulose and we use it to stabilize and strengthen foams. The foaming process is very easy. The Methocel F50 is mixed into a flavorful liquid and then, using a standing mixer with a whisk attachment, it is whipped into soft peaks. The foam can then be spooned out, put in a pastry bag, or dehydrated. Xanthan gum is also commonly used to add more stability to the foam. This is a standard foam recipe using Methocel F50 and xanthan gum. You can vary the liquid to be whatever you need for your dish. The cherry foam is awesome with a seared duck breast and pecans, or even on chocolate cake or cherry pie. Taste the cherry juice and if it needs sweetening add some sugar or honey to balance the flavors. Place the cherry juice in a standing blender and turn it on to a speed where a vortex forms. Sprinkle the Methocel F50 and xanthan gum into the vortex and continue to blend for 30 to 60 seconds to ensure even dispersion. Place the cherry juice in the refrigerator for several hours to hydrate. Once fully hydrated, remove the cherry juice mixture from the refrigerator and whip it with the standing mixer until peaks form, about 5 to 10 minutes. Once the peaks have formed the foam is ready to be served. You can serve the foam by spooning it directly onto the dish. For a more refined presentation you can spoon it into a pastry bag or a ziploc bag with the corner cut off and pipe out small mounds or a long line of foam. You can dehydrate the foam if you want to make firm meringues. Line a dehydrator tray with a silicone mat or parchment paper. Pipe small mounds onto the tray. Dehydrate for 3 to 5 hours, until they turn crispy and are fully dehydrated.
methocel f50 is a variety of methylcellulose and we use it to stabilize and strengthen foams. the foaming process is very easy. the methocel f50 is mixed into a flavorful liquid and then, using a standing mixer with a whisk attachment, it is whipped into soft peaks. the foam can then be spooned out, put in a pastry bag, or dehydrated. xanthan gum is also commonly used to add more stability to the foam. this is a standard foam recipe using methocel f50 and xanthan gum. you can vary the liquid to be whatever you need for your dish. the cherry foam is awesome with a seared duck breast and pecans, or even on chocolate cake or cherry pie. taste the cherry juice and if it needs sweetening add some sugar or honey to balance the flavors. place the cherry juice in a standing blender and turn it on to a speed where a vortex forms. sprinkle the methocel f50 and xanthan gum into the vortex and continue to blend for 30 to 60 seconds to ensure even dispersion. place the cherry juice in the refrigerator for several hours to hydrate. once fully hydrated, remove the cherry juice mixture from the refrigerator and whip it with the standing mixer until peaks form, about 5 to 10 minutes. once the peaks have formed the foam is ready to be served. you can serve the foam by spooning it directly onto the dish. for a more refined presentation you can spoon it into a pastry bag or a ziploc bag with the corner cut off and pipe out small mounds or a long line of foam. you can dehydrate the foam if you want to make firm meringues. line a dehydrator tray with a silicone mat or parchment paper. pipe small mounds onto the tray. dehydrate for 3 to 5 hours, until they turn crispy and are fully dehydrated.
The Lego Movie is a film written and directed by Phil Lord and Christopher Miller. The film follows an ordinary Lego minifigure named Emmet (Chris Pratt). Emmet is an average Lego—he always follows the rules and gives into the mindless lifestyle that is demanded of him. However, when he is mistaken for an extraordinarily special person that has been prophesied to save the world, he is thrust into a thrilling quest with a band of Lego strangers to take down the evil despot, Lord Business (Will Ferrell). Traditionally, I am not a huge fan of animated features. My feeling is that most of the modern animated films, with only a few exceptions (e.g., most Pixar films), are senseless, poorly written stories that are meant to simply target children and achieve immense box office success through that exploitation. I have no issues with this business tactic by the animation studios, but my point is only that it does not make for good film. However, The Lego Movie breaks the mold for modern animation storytelling. It does an incredible job of appealing to young kids who play with Legos with its music, humor, and positive story, but I was most impressed, as a twentysomething, with the film’s ability to appeal to adults. The jokes, plot, and character arcs are obviously appropriate for children of all ages, but they seem hilariously crafted with those of my age group in mind. Additionally, the story ever so gradually tugs at the heartstrings of anyone that has ever played with the world-famous toys in their life. It not only allows children to see their favorite toys on the big screen, but it also brings back a wealth of memories from days gone by from adults’ (and specifically, my) creative adventures with Legos. The film has won a number of awards already for being the Best Animated Feature of 2014, which is why I am appalled that it was snubbed by the Oscars in that category. In recent memory, this is the worst snub the Academy has made. Everything discussed in the previous paragraph is directly attributable to the well-crafted script and the exceptional direction from the film’s creators, Phil Lord and Christopher Miller. This duo has a unique filmography, writing and directing Cloudy with a Chance of Meatballs and directing both 21 Jump Street and 22 Jump Street. Their experiences with animated films (they also wrote the script for Cloudy with a Chance of Meatballs 2) is starkly different to that of their R-rated Jump Street comedies, but the Lord-Miller team gets the best out of both worlds for The Lego Movie. It is a remarkable achievement that has already garnered its creators a series of spin-off films that are in the works, not to mention a sequel to The Lego Movie. These guys are becoming a staple in the world of animated film, and we are all luckier for that. The script is as solid as it gets, but naturally, it still needs a group of talented actors to breathe life into its characters. Voice acting is always a unique challenge, but Lord and Miller put together an all-star cast for the task. The film has a wide range of standout performances from its actors, including Chris Pratt as Emmet, Will Ferrell as Lord Business, Elizabeth Banks as Wyldstyle, Will Arnett as Batman, Nick Offerman as Metal Beard, Alison Brie as Princess Unikitty, Charlie Day as Benny, Liam Neeson as Bad Cop, Good Cop, and Morgan Freeman as Vitruvius. Make sure to check this one out if you are looking to see a perfect comedy—it is by far the year’s best. At the very least, you will be left with one of the greatest songs in film history stuck in your head…”Everything is awesome!!!” The Lego Movie is rated PG for mild action and rude humor.
the lego movie is a film written and directed by phil lord and christopher miller. the film follows an ordinary lego minifigure named emmet (chris pratt). emmet is an average lego—he always follows the rules and gives into the mindless lifestyle that is demanded of him. however, when he is mistaken for an extraordinarily special person that has been prophesied to save the world, he is thrust into a thrilling quest with a band of lego strangers to take down the evil despot, lord business (will ferrell). traditionally, i am not a huge fan of animated features. my feeling is that most of the modern animated films, with only a few exceptions (e.g., most pixar films), are senseless, poorly written stories that are meant to simply target children and achieve immense box office success through that exploitation. i have no issues with this business tactic by the animation studios, but my point is only that it does not make for good film. however, the lego movie breaks the mold for modern animation storytelling. it does an incredible job of appealing to young kids who play with legos with its music, humor, and positive story, but i was most impressed, as a twentysomething, with the film’s ability to appeal to adults. the jokes, plot, and character arcs are obviously appropriate for children of all ages, but they seem hilariously crafted with those of my age group in mind. additionally, the story ever so gradually tugs at the heartstrings of anyone that has ever played with the world-famous toys in their life. it not only allows children to see their favorite toys on the big screen, but it also brings back a wealth of memories from days gone by from adults’ (and specifically, my) creative adventures with legos. the film has won a number of awards already for being the best animated feature of 2014, which is why i am appalled that it was snubbed by the oscars in that category. in recent memory, this is the worst snub the academy has made. everything discussed in the previous paragraph is directly attributable to the well-crafted script and the exceptional direction from the film’s creators, phil lord and christopher miller. this duo has a unique filmography, writing and directing cloudy with a chance of meatballs and directing both 21 jump street and 22 jump street. their experiences with animated films (they also wrote the script for cloudy with a chance of meatballs 2) is starkly different to that of their r-rated jump street comedies, but the lord-miller team gets the best out of both worlds for the lego movie. it is a remarkable achievement that has already garnered its creators a series of spin-off films that are in the works, not to mention a sequel to the lego movie. these guys are becoming a staple in the world of animated film, and we are all luckier for that. the script is as solid as it gets, but naturally, it still needs a group of talented actors to breathe life into its characters. voice acting is always a unique challenge, but lord and miller put together an all-star cast for the task. the film has a wide range of standout performances from its actors, including chris pratt as emmet, will ferrell as lord business, elizabeth banks as wyldstyle, will arnett as batman, nick offerman as metal beard, alison brie as princess unikitty, charlie day as benny, liam neeson as bad cop, good cop, and morgan freeman as vitruvius. make sure to check this one out if you are looking to see a perfect comedy—it is by far the year’s best. at the very least, you will be left with one of the greatest songs in film history stuck in your head…”everything is awesome!!!” the lego movie is rated pg for mild action and rude humor.
Tournament Time: Tournament Registration and Free Play will be starting at 11:00AM, however we be starting the event at 12:30 PM. It would be appreciated, however, if attendees would be there at least a couple of minutes earlier so we can get the battles and or blocks ready beforehand. We'd like to get the tournament done as soon as we can, but if your going to be late PM me or post in this thread. Venue MAY change for a better park! Stay tuned in a few days! Would anyone be interested in buying a black Spriggan Requiem? Can Takara Tomy beys be used in this tournament or just Hasbro? (Sep. 23, 2018 3:48 PM)Beythegood Wrote: Can Takara Tomy beys be used in this tournament or just Hasbro? i’m sad we can’t make it next week. have fun folks, i’m interested to see if gF makes an impact! Can I use my takara tomys? (Sep. 25, 2018 6:24 AM)gray kurokin Wrote: Can I use my takara tomys? (Sep. 23, 2018 2:50 PM)CrimsonBurst Wrote: Would anyone be interested in buying a black Spriggan Requiem? Dos anyone have xtra beylogger sheets I can have? Do we need to do anything in advance, or just show up and register once we're there? Do they really need their own accounts on this site, or can I register them both under mine? We've gone over all the rules together, but as a non-blader only some of it makes sense to me. Will the kids be able to just follow the lead of the more-experienced players? Do they need to bring anything other than their favorite official beyblades? We don't have one of the approved arenas. Anything else we should know as first-timers? there will be experienced judges who know the tournament rules. your kids can just watch other matches and learn. it’s fast to pick up. if they don’t understand something, just ask a judge. ... if you are having thoughts about joining, GO 4 IT, it IS amazing!!!! GOOD LUCK TODAY TO EVERYONE! NOW TIME TO HAVE FUN!! Had alot of fun today every 1 Good Games all around. Just wondering, but what do credits do? (Oct. 01, 2018 11:44 AM)Z3t.i Wrote: Just wondering, but what do credits do? Seriously, what do credits do?
tournament time: tournament registration and free play will be starting at 11:00am, however we be starting the event at 12:30 pm. it would be appreciated, however, if attendees would be there at least a couple of minutes earlier so we can get the battles and or blocks ready beforehand. we'd like to get the tournament done as soon as we can, but if your going to be late pm me or post in this thread. venue may change for a better park! stay tuned in a few days! would anyone be interested in buying a black spriggan requiem? can takara tomy beys be used in this tournament or just hasbro? (sep. 23, 2018 3:48 pm)beythegood wrote: can takara tomy beys be used in this tournament or just hasbro? i’m sad we can’t make it next week. have fun folks, i’m interested to see if gf makes an impact! can i use my takara tomys? (sep. 25, 2018 6:24 am)gray kurokin wrote: can i use my takara tomys? (sep. 23, 2018 2:50 pm)crimsonburst wrote: would anyone be interested in buying a black spriggan requiem? dos anyone have xtra beylogger sheets i can have? do we need to do anything in advance, or just show up and register once we're there? do they really need their own accounts on this site, or can i register them both under mine? we've gone over all the rules together, but as a non-blader only some of it makes sense to me. will the kids be able to just follow the lead of the more-experienced players? do they need to bring anything other than their favorite official beyblades? we don't have one of the approved arenas. anything else we should know as first-timers? there will be experienced judges who know the tournament rules. your kids can just watch other matches and learn. it’s fast to pick up. if they don’t understand something, just ask a judge. ... if you are having thoughts about joining, go 4 it, it is amazing!!!! good luck today to everyone! now time to have fun!! had alot of fun today every 1 good games all around. just wondering, but what do credits do? (oct. 01, 2018 11:44 am)z3t.i wrote: just wondering, but what do credits do? seriously, what do credits do?
As much as living alone sounds like a rock star lifestyle, there are various times in our lives when this is not feasible, and choosing a flatmate is a necessity. House sharing can form friends for life, be a crazy whirlwind of emotions or a strange and painful experience. Whichever way it goes, you need to make sure you know exactly what you are looking for in a new flatmate. Implementing some basic housemate filters can make a drastic difference in the flatting experience, and save you from all sorts of disasters. The first and most important thing to do is write a wish list. What qualities in a flatmate are a must. You need to think about the lifestyle you live, and find someone that fits in with that. Consider your work schedule, partner, chores and what you do in your downtime, as a similar schedule means a harmonise living environment. Do you like a quiet home or a party hub? Do you like the house filled with people, or prefer the company of yourself? Do you want to make close friends with your potential flatmate, or only give each other a slight smile as you walk out the door? It is a smart idea to have a phone call before meeting up with potential flatmates, mainly for safety but also to not waste your time. Call them and ask questions based on the qualities you listed on your wish list. This way you can rule out those who don’t have the same ideas as you, and schedule a face to face with those who do. As creepy as it sounds, give them a Facebook and Instagram stalk to see if they do really ‘love being at home on a Saturday night’ like they said, before you schedule a meeting. Meeting in a public place for the first time is a safe and smart idea. Meeting for a coffee or a drink first is a safe way to get to know the person, without putting yourself at risk. Once you have filtered through potential option, it is a good idea to discuss lifestyle and monetary questions. Without being too evasive, ask them key financial questions like what are you currently paying? Do you have other financial commitments such as a car lease or student loans? What position they are in at their job? These kinds of questions gauge the person’s responsibilities and financial stability to be able to pay rent on time. Secondly, ask them lifestyle questions, as most household dramas come from dramatically different lifestyle choices. Most important is asking them what their cleaning routine is, nothing is worse than coming home to a messy house, when you prefer a spotless one. Next, ask them what their work schedule is like, what days do they have off? Do they like staying at home watching movies, or being out on an outdoor adventure? Are they vegetarian or enjoy a big cook up on the barbeque? Asking these basic lifestyle questions will eliminate potential fights over the TV or disagreements over cooking. After all these questions and comments it ultimately comes down to who you feel most comfortable around. After all your questions have been answered, choose someone who most closely fits with your ideals and whose company you genuinely enjoyed.
as much as living alone sounds like a rock star lifestyle, there are various times in our lives when this is not feasible, and choosing a flatmate is a necessity. house sharing can form friends for life, be a crazy whirlwind of emotions or a strange and painful experience. whichever way it goes, you need to make sure you know exactly what you are looking for in a new flatmate. implementing some basic housemate filters can make a drastic difference in the flatting experience, and save you from all sorts of disasters. the first and most important thing to do is write a wish list. what qualities in a flatmate are a must. you need to think about the lifestyle you live, and find someone that fits in with that. consider your work schedule, partner, chores and what you do in your downtime, as a similar schedule means a harmonise living environment. do you like a quiet home or a party hub? do you like the house filled with people, or prefer the company of yourself? do you want to make close friends with your potential flatmate, or only give each other a slight smile as you walk out the door? it is a smart idea to have a phone call before meeting up with potential flatmates, mainly for safety but also to not waste your time. call them and ask questions based on the qualities you listed on your wish list. this way you can rule out those who don’t have the same ideas as you, and schedule a face to face with those who do. as creepy as it sounds, give them a facebook and instagram stalk to see if they do really ‘love being at home on a saturday night’ like they said, before you schedule a meeting. meeting in a public place for the first time is a safe and smart idea. meeting for a coffee or a drink first is a safe way to get to know the person, without putting yourself at risk. once you have filtered through potential option, it is a good idea to discuss lifestyle and monetary questions. without being too evasive, ask them key financial questions like what are you currently paying? do you have other financial commitments such as a car lease or student loans? what position they are in at their job? these kinds of questions gauge the person’s responsibilities and financial stability to be able to pay rent on time. secondly, ask them lifestyle questions, as most household dramas come from dramatically different lifestyle choices. most important is asking them what their cleaning routine is, nothing is worse than coming home to a messy house, when you prefer a spotless one. next, ask them what their work schedule is like, what days do they have off? do they like staying at home watching movies, or being out on an outdoor adventure? are they vegetarian or enjoy a big cook up on the barbeque? asking these basic lifestyle questions will eliminate potential fights over the tv or disagreements over cooking. after all these questions and comments it ultimately comes down to who you feel most comfortable around. after all your questions have been answered, choose someone who most closely fits with your ideals and whose company you genuinely enjoyed.
Syberia 2 • View topic - [Solved] Music cylinder requires CD? Board index ‹ ENGLISH ‹ EN - Technical Support ‹ [Solved] Music cylinder requires CD? [Solved] Music cylinder requires CD? I am not sure anyone responds to this support email but I really don't know where to turn on this. I purchased Syberia 1 as a download. The game installed just fine and has been playing relatively well to this point. I got to a place in the game where I used a music cylinder on a music box and the game halts and asks me to insert the Syberia 1 CD. I thought maybe if I downloaded and installed the patch from the Downloads section of the web site, but when I try to run that patch, it says I don't have the game installed. Suggestions? Re: Music cylinder requires CD? yes, download the savegame just after using the music cylinder on the music box. Actually, I got a reply from Microids. The fix involved renaming some video files and moving them to the proper directory. The tech person who sent me the fix indicated that they were working on fixing the problem permanently and having a correct download file available. I did what the person suggested and the games plays just fine. Re: [Solved] Music cylinder requires CD? Any chance somebody could post the fix mentioned by Rhiannon on this thread. I've tried installing Patch 3 on my downloaded game but it does not recognize the installation. It appears Microids tech support answered Rhiannon two years ago. Normally downloads include all patches. If you are at the same point in the game the "save game" link still works. Did you see the suggestions in the support area of this website? After mucking about with the patches and compatability mode I lost all my games saves, but then installed the gamesave from this thread and now run the game in Windows 98 compatability mode and so far so good.
syberia 2 • view topic - [solved] music cylinder requires cd? board index ‹ english ‹ en - technical support ‹ [solved] music cylinder requires cd? [solved] music cylinder requires cd? i am not sure anyone responds to this support email but i really don't know where to turn on this. i purchased syberia 1 as a download. the game installed just fine and has been playing relatively well to this point. i got to a place in the game where i used a music cylinder on a music box and the game halts and asks me to insert the syberia 1 cd. i thought maybe if i downloaded and installed the patch from the downloads section of the web site, but when i try to run that patch, it says i don't have the game installed. suggestions? re: music cylinder requires cd? yes, download the savegame just after using the music cylinder on the music box. actually, i got a reply from microids. the fix involved renaming some video files and moving them to the proper directory. the tech person who sent me the fix indicated that they were working on fixing the problem permanently and having a correct download file available. i did what the person suggested and the games plays just fine. re: [solved] music cylinder requires cd? any chance somebody could post the fix mentioned by rhiannon on this thread. i've tried installing patch 3 on my downloaded game but it does not recognize the installation. it appears microids tech support answered rhiannon two years ago. normally downloads include all patches. if you are at the same point in the game the "save game" link still works. did you see the suggestions in the support area of this website? after mucking about with the patches and compatability mode i lost all my games saves, but then installed the gamesave from this thread and now run the game in windows 98 compatability mode and so far so good.
Pop-Up Stopper Professional is the only ad-blocker to block all windows pop up and perform files tracking in every browser on every Internet connection. Pop-Up Stopper Professional is an advanced application that blocks or close rapid pop-up and pop - under on all browsers, including AOL, MSN, Internet Explorer, Netscape, SBCYahoo! WMConnect, Opera and many others. Pop-Up Stopper Professional can optionally download free updates. It is a simple utility that perform many effective tasks like, Clean and manage cookies in all browsers, Delete the browser history and memory cache and even clead index.dat files, even for the users and the separate logins. Panicware technology enables users to allow pop-ups from specific websites. Preserve bandwidth by blocking pop-up windows before they are charged. Pop-Up Stopper Professional is a lightweight Windows application specifically designed to help block the annoying and stubborn pop-ups that appear when you browse the Internet. The tool provides support for AOL, Internet Explorer, Netscape, Opera, WMConnect, Firefox, and others.
pop-up stopper professional is the only ad-blocker to block all windows pop up and perform files tracking in every browser on every internet connection. pop-up stopper professional is an advanced application that blocks or close rapid pop-up and pop - under on all browsers, including aol, msn, internet explorer, netscape, sbcyahoo! wmconnect, opera and many others. pop-up stopper professional can optionally download free updates. it is a simple utility that perform many effective tasks like, clean and manage cookies in all browsers, delete the browser history and memory cache and even clead index.dat files, even for the users and the separate logins. panicware technology enables users to allow pop-ups from specific websites. preserve bandwidth by blocking pop-up windows before they are charged. pop-up stopper professional is a lightweight windows application specifically designed to help block the annoying and stubborn pop-ups that appear when you browse the internet. the tool provides support for aol, internet explorer, netscape, opera, wmconnect, firefox, and others.
Ok. I can mill 2D objects no probs. This picture is just an example I made so you can see what I am trying to do. I have milled the object all apart from the slot on the left. What is the simplest way to do this ?. I have today tried to create a 3D version in FreeCAD software, but when imported to Cambam, I have no Idea what to do with it. Especialy as I only want the slot. Maybe there is a way in Cambam, that lets me do this without getting into 3D ? whats the radius of the slot? or is it a true semicircle so diameter = 22.226mm (spurious level of accuracy aside), or 7/8". Maybe you can find a 7/8" ball nose cutter. Edited my post, but not quickly enough.. got my radii and diameters confused (its the heat). Don't think cambam can do that. If you can find a 7/8 cutter and get it in your spindle the doc isn't an issue, just go round and round. Hhhmm chinese spindle. I dont know if the speed will cope too low with such a large endmill . If Cambam wont do it, what software will ? Or maybe something inside Mach3 ?? But you aren't trying to cut a semi-circular slot, you are trying to cut a semi-circular slot with something at the ends so the software knows what to do when it gets there. The tool needs to know where it can overhang. Given half a chance any self respecting software will not view this as a pocket sinking exercise. That way it can cut the outline when it reaches the end. Simples. The easiest way is to write a quick program that spits out a G code, that way you can be sure you get a finishing cut that increments to the face rather than the depth. Pitty I cant get Cambam to do it though. Have you tried the CamBam forum? There are some very knowledgeable people on there. What is the simplest way to do this ?. I would draw the slot as a line longer than you need draw a semi-circle to the size you want and extrude the semi C along the line, create your tool path using a bull-nosed cutter, using center line of where you want to put slot across the part, use this as XYZ = 0 set your cutter & g-code to run from there, it should cut a semi-circle across the part. This is the bit, Im not sure how to do ? first draw a line longer than you need so you have overcut of the part, then draw a semi circle like the one in red in your software look for extrude, pick the line as your length of cut, then pick the semi C as your profile and merge them together, you need to orientate your part or the drawing to cross your part using the top face of the part as the XYZ =0 you end up with a semi circle cut into the part as shown. Hope it helps, if not give me the exact sizes of the part you want to cross and the size of the semi circle and I will do you a code to cut. ah that's probably why. I don't have "extrude" in my CAD software. What software are you running for example ? Take a look at the 4th paragraph down Extrude. Ok found the Extrude in Cambam. I managed to make a 3D circle , but I am now stuck on how the merge them together. and I cant get the circle/cylinder to follow the same axis as the line. Sorry for my lack of understanding here ! disregard my first idea as this was done in Vetric, in Cambam first create the semi circle then extrude upwards to the over length you require then follow the instruction to rotate the part. (To create extrusions along other axis, the shape must first be extruded in Z, then rotate the extruded surface object to the required orientation. The Extrude operation will first prompt for an Extrusion Height. This will be the Z height of the extruded surface. A positive height will extend toward the positive Z axis (ie toward the viewer when drawing is in the normal orientation with the XY plane parallel to the screen). A negative height will extend the surface along the negative Z axis (ie into the screen). Ok. This is going to raise answers that probably are obvious that it is not the correct method to do this, but still I want to try. I want to cut 2 slots (2mm wide and 30mm deep from 2 sides / length around 35mm) though the 6082 T6 billet. Using a single or 2 flute 2mm endmill, I know the DOC is going to have to be tiny maybe 0.25mm ?. I am using flood coolant. I think 10mm is probably the max flute length for any 2mm dia endmill. Maybe I can find one somewhere that will stretch to 15mm, but I doubt it. What you need is called a rib cutter. The sides of the cut support the tool, only the very tip is fluted. It cuts the slot that puts a rib onto an injection moulded component.
ok. i can mill 2d objects no probs. this picture is just an example i made so you can see what i am trying to do. i have milled the object all apart from the slot on the left. what is the simplest way to do this ?. i have today tried to create a 3d version in freecad software, but when imported to cambam, i have no idea what to do with it. especialy as i only want the slot. maybe there is a way in cambam, that lets me do this without getting into 3d ? whats the radius of the slot? or is it a true semicircle so diameter = 22.226mm (spurious level of accuracy aside), or 7/8". maybe you can find a 7/8" ball nose cutter. edited my post, but not quickly enough.. got my radii and diameters confused (its the heat). don't think cambam can do that. if you can find a 7/8 cutter and get it in your spindle the doc isn't an issue, just go round and round. hhhmm chinese spindle. i dont know if the speed will cope too low with such a large endmill . if cambam wont do it, what software will ? or maybe something inside mach3 ?? but you aren't trying to cut a semi-circular slot, you are trying to cut a semi-circular slot with something at the ends so the software knows what to do when it gets there. the tool needs to know where it can overhang. given half a chance any self respecting software will not view this as a pocket sinking exercise. that way it can cut the outline when it reaches the end. simples. the easiest way is to write a quick program that spits out a g code, that way you can be sure you get a finishing cut that increments to the face rather than the depth. pitty i cant get cambam to do it though. have you tried the cambam forum? there are some very knowledgeable people on there. what is the simplest way to do this ?. i would draw the slot as a line longer than you need draw a semi-circle to the size you want and extrude the semi c along the line, create your tool path using a bull-nosed cutter, using center line of where you want to put slot across the part, use this as xyz = 0 set your cutter & g-code to run from there, it should cut a semi-circle across the part. this is the bit, im not sure how to do ? first draw a line longer than you need so you have overcut of the part, then draw a semi circle like the one in red in your software look for extrude, pick the line as your length of cut, then pick the semi c as your profile and merge them together, you need to orientate your part or the drawing to cross your part using the top face of the part as the xyz =0 you end up with a semi circle cut into the part as shown. hope it helps, if not give me the exact sizes of the part you want to cross and the size of the semi circle and i will do you a code to cut. ah that's probably why. i don't have "extrude" in my cad software. what software are you running for example ? take a look at the 4th paragraph down extrude. ok found the extrude in cambam. i managed to make a 3d circle , but i am now stuck on how the merge them together. and i cant get the circle/cylinder to follow the same axis as the line. sorry for my lack of understanding here ! disregard my first idea as this was done in vetric, in cambam first create the semi circle then extrude upwards to the over length you require then follow the instruction to rotate the part. (to create extrusions along other axis, the shape must first be extruded in z, then rotate the extruded surface object to the required orientation. the extrude operation will first prompt for an extrusion height. this will be the z height of the extruded surface. a positive height will extend toward the positive z axis (ie toward the viewer when drawing is in the normal orientation with the xy plane parallel to the screen). a negative height will extend the surface along the negative z axis (ie into the screen). ok. this is going to raise answers that probably are obvious that it is not the correct method to do this, but still i want to try. i want to cut 2 slots (2mm wide and 30mm deep from 2 sides / length around 35mm) though the 6082 t6 billet. using a single or 2 flute 2mm endmill, i know the doc is going to have to be tiny maybe 0.25mm ?. i am using flood coolant. i think 10mm is probably the max flute length for any 2mm dia endmill. maybe i can find one somewhere that will stretch to 15mm, but i doubt it. what you need is called a rib cutter. the sides of the cut support the tool, only the very tip is fluted. it cuts the slot that puts a rib onto an injection moulded component.
Infertility is suffering enough and thus you would not wish to add any further suffering! One smart step in decreasing the likelihood of multiplying your troubles is by selecting best infertility clinics. And you can do that by rigorously checking their services and completeness of their working staff. The working people could not actually be present during your clinical visit however the clinic must at least make an assurance that the following infertility specialists are available in case you will need them. This is the person who conducts the follicular recruitment phases in all assisted reproduction technologies. Thus, he stands important in dealing with infertility. And because this personage specializes in many areas related to infertility such as endometriosis, reproductive organ disorders and uterine abnormalities he is vital during surgical repairs and surgery-associated techniques. For infertile patients who have immunological barriers as the primary cause of their infertility, it is essential that a reproductive immunologist is always at hand so as to provide extensive analysis and diagnosis of the condition. Though many areas of conditions that cover immunological barriers are not readily facilitated in standard laboratories, the infertility clinic for which you have subscribed must have a strong affiliation to services that offer treatments with this condition. The infertility clinic must at least have one embryologist specializing in fields like pre-implantation embryology, fertilization events (pre- and post), and andrology. An embryologist must be a doctor of medicine or must have a doctorate on physical, chemical or biological science. While it is not necessary that an urologist is regularly present in an infertility clinic, the facility must still provide a strong assurance that one will respond in case the patients need him. An urologist is a specialist in the diagnosis and treatment of infertility covering male factors. Andorlogists are more like laboratory specialists rather than people detailing the anatomical background of infertility. They focus on the physiology relating to infertility, treatment cycle for which assisted reproductive technologies are largely based, and biochemistry. They are responsible in developing and handling procedures in aid of fertilization in larger infertility laboratories where they work closely with other specialists in inducing assisted fertilization. A number of problems in infertility are actually based on the genetic factors that largely affect the capacity of a person to conceive. Thus, the need for an authority in genetics. Some cases of infertility are grounded on genetic abnormalities such as Tay Sachs syndrome, Klinefelters disease, sickle cell anemia and thalassemia.
infertility is suffering enough and thus you would not wish to add any further suffering! one smart step in decreasing the likelihood of multiplying your troubles is by selecting best infertility clinics. and you can do that by rigorously checking their services and completeness of their working staff. the working people could not actually be present during your clinical visit however the clinic must at least make an assurance that the following infertility specialists are available in case you will need them. this is the person who conducts the follicular recruitment phases in all assisted reproduction technologies. thus, he stands important in dealing with infertility. and because this personage specializes in many areas related to infertility such as endometriosis, reproductive organ disorders and uterine abnormalities he is vital during surgical repairs and surgery-associated techniques. for infertile patients who have immunological barriers as the primary cause of their infertility, it is essential that a reproductive immunologist is always at hand so as to provide extensive analysis and diagnosis of the condition. though many areas of conditions that cover immunological barriers are not readily facilitated in standard laboratories, the infertility clinic for which you have subscribed must have a strong affiliation to services that offer treatments with this condition. the infertility clinic must at least have one embryologist specializing in fields like pre-implantation embryology, fertilization events (pre- and post), and andrology. an embryologist must be a doctor of medicine or must have a doctorate on physical, chemical or biological science. while it is not necessary that an urologist is regularly present in an infertility clinic, the facility must still provide a strong assurance that one will respond in case the patients need him. an urologist is a specialist in the diagnosis and treatment of infertility covering male factors. andorlogists are more like laboratory specialists rather than people detailing the anatomical background of infertility. they focus on the physiology relating to infertility, treatment cycle for which assisted reproductive technologies are largely based, and biochemistry. they are responsible in developing and handling procedures in aid of fertilization in larger infertility laboratories where they work closely with other specialists in inducing assisted fertilization. a number of problems in infertility are actually based on the genetic factors that largely affect the capacity of a person to conceive. thus, the need for an authority in genetics. some cases of infertility are grounded on genetic abnormalities such as tay sachs syndrome, klinefelters disease, sickle cell anemia and thalassemia.
fair and how it has created a ‘scything community.’ Can anyone help? I’m not sure I (Beth) can manage it with a new baby. (where we live) we decided to bring the scythe into the city. with a scythe, happen in parks of Vienna. near the cities vineyards at Cobenzl. every egg on the grass with the machines. Now we mow there every two months. morning mowing before they go to work. but that takes is to the network around us, which is another story.
fair and how it has created a ‘scything community.’ can anyone help? i’m not sure i (beth) can manage it with a new baby. (where we live) we decided to bring the scythe into the city. with a scythe, happen in parks of vienna. near the cities vineyards at cobenzl. every egg on the grass with the machines. now we mow there every two months. morning mowing before they go to work. but that takes is to the network around us, which is another story.
Televisionista: Steven Weber Joins "Desperate Housewives" Steven Weber Joins "Desperate Housewives" Steven Weber ("Wings," "Studio 60 on the Sunset Strip), who romanced Rachel Griffiths on ABC's Sunday night dramedy "Brothers & Sisters" last season is coming back to the same network and night this year, but he will now be seen an hour earlier raising eyebrows with a young lady on Wisteria Lane. According to EW's Ausiello: "When Susan Mayer's (Teri Hatcher) now-adult daughter Julie (Andrea Bowen) returns to Wisteria Lane next month, she'll be bringing along one helluva surprise: boyfriend Steven Weber." The show producers have cast Weber as Julie's thrice-divorced college professor-turned-lover, whose sudden appearance leads Susan to double her crazy pill intake. The actor (and former "Desperate Housewives" regular Bowen) will only appear in one episode so far.
televisionista: steven weber joins "desperate housewives" steven weber joins "desperate housewives" steven weber ("wings," "studio 60 on the sunset strip), who romanced rachel griffiths on abc's sunday night dramedy "brothers & sisters" last season is coming back to the same network and night this year, but he will now be seen an hour earlier raising eyebrows with a young lady on wisteria lane. according to ew's ausiello: "when susan mayer's (teri hatcher) now-adult daughter julie (andrea bowen) returns to wisteria lane next month, she'll be bringing along one helluva surprise: boyfriend steven weber." the show producers have cast weber as julie's thrice-divorced college professor-turned-lover, whose sudden appearance leads susan to double her crazy pill intake. the actor (and former "desperate housewives" regular bowen) will only appear in one episode so far.
Whoa, Zac! Where did those muscles come from? I'm the resident Zac Efron fan-girl in the GLAMOUR office - much to the annoyance of some of the other ladies who don't understand the appeal. I don't know what it is but there's just something about his baby blue eyes and his Hollywood smile that I just swoon over. And now he's added another reason to fancy him - his biceps. I've got to admit, they're a bit too big - as one fellow co-worker pointed out, his arms are bigger than his legs, and I'm not sure how I feel about that, if I'm being completely honest. Zac - or should we call him the Efronator - showed off his ripped muscles while on a solo hike on Sunday in Hawaii. Solo, you say? I'm not sure where his new girlfriend, Sami Miro, was but if he ever needs a hiking companion in the future, I'm more than happy to stand in. The next day, the 27-year-old actor posted a pic of himself to honour Memorial Day and wrote on Twitter, "Trailing up the military pillbox hike in Hawaii and remembering our troops. Thank you for your service #Memorialday." Zac just wrapped up filming on his upcoming film Dirty Grandpa and will start work on his other new film, Mike and Dave Need Wedding Dates, soon.
whoa, zac! where did those muscles come from? i'm the resident zac efron fan-girl in the glamour office - much to the annoyance of some of the other ladies who don't understand the appeal. i don't know what it is but there's just something about his baby blue eyes and his hollywood smile that i just swoon over. and now he's added another reason to fancy him - his biceps. i've got to admit, they're a bit too big - as one fellow co-worker pointed out, his arms are bigger than his legs, and i'm not sure how i feel about that, if i'm being completely honest. zac - or should we call him the efronator - showed off his ripped muscles while on a solo hike on sunday in hawaii. solo, you say? i'm not sure where his new girlfriend, sami miro, was but if he ever needs a hiking companion in the future, i'm more than happy to stand in. the next day, the 27-year-old actor posted a pic of himself to honour memorial day and wrote on twitter, "trailing up the military pillbox hike in hawaii and remembering our troops. thank you for your service #memorialday." zac just wrapped up filming on his upcoming film dirty grandpa and will start work on his other new film, mike and dave need wedding dates, soon.
Tucker Trail Saddles are constantly researching, developing, and implementing the latest in design and technique to provide you with the best possible trail saddles available. Tucker uses world-class leather, hardware and trees that are specially made to their specifications and guidelines from the finest tanneries and hardware manufacturers available. Products are proudly made in the U.S.A. Tucker Split Rein. Tucker's durable bridle reins are oiled and hand finished with rolled edges for rider's comfort. Snap and detachable water tie flap at bit end. The same useful design as the Standard Halter Bridle, but in a lighter, more streamlined design. Made from the same fine bridle leather. Crown 19", Cheeks 9 1/2", Noseband 28", Throat 21" Tucker Horizon Montreal Breast Collar is constructed of soft and supple moisture repellent leather, beautifully accented with black engraved buckles. Designed with comfort, quality and convenience in mind, this breast strap is as functional as it is beautiful. Tucker Horizon Series Browband Headstall is constructed of soft and supple moisture repellent leather, beautifully accented with black engraved buckles and scalloped cheeks with detailed leather tooling. Designed with comfort and convenience in mind. Tucker Horizon Outpost Endurance Trail Saddle features no horn to impede bending under low hanging branches or jumping, an ergonomic shock absorbing seat and an advanced flexible panel system to evenly distribute weight. Tucker is the original trail saddle designed based on thousands of hours of trail riding feedback, offering comfort second to none!
tucker trail saddles are constantly researching, developing, and implementing the latest in design and technique to provide you with the best possible trail saddles available. tucker uses world-class leather, hardware and trees that are specially made to their specifications and guidelines from the finest tanneries and hardware manufacturers available. products are proudly made in the u.s.a. tucker split rein. tucker's durable bridle reins are oiled and hand finished with rolled edges for rider's comfort. snap and detachable water tie flap at bit end. the same useful design as the standard halter bridle, but in a lighter, more streamlined design. made from the same fine bridle leather. crown 19", cheeks 9 1/2", noseband 28", throat 21" tucker horizon montreal breast collar is constructed of soft and supple moisture repellent leather, beautifully accented with black engraved buckles. designed with comfort, quality and convenience in mind, this breast strap is as functional as it is beautiful. tucker horizon series browband headstall is constructed of soft and supple moisture repellent leather, beautifully accented with black engraved buckles and scalloped cheeks with detailed leather tooling. designed with comfort and convenience in mind. tucker horizon outpost endurance trail saddle features no horn to impede bending under low hanging branches or jumping, an ergonomic shock absorbing seat and an advanced flexible panel system to evenly distribute weight. tucker is the original trail saddle designed based on thousands of hours of trail riding feedback, offering comfort second to none!
Its user base comprises of over 200 billion all around the world. It recommended anti-virus for defending all sorts of virus halt the malware attack. Within this feature, anti-virus defends you from several types of hacking that are perfect for your privacy and secure data. AVG Anti-Virus includes our special Link Scanner to keep you from accidentally visiting harmful websites. The antivirus solutions supplied by AVG quickly made it to the top, as a result of their capacity to shield computers from the most recent threats via strong shields against spyware and internet malware. AVG Antivirus 2019 is among the best antiviruses for computers and cellular phones. Avast provides an extremely similar feature, even though it’s installed by default in place of on first use. AVG Antivirus serial keys are extremely easy and simple to use. AVG 2019 Apk Mod Revdl crack is among the very best businesses that provide quality security solutions. Utilize your PC even if it doesn’t get the job done. This pack will certainly enhance the outdoor setting of your dwelling. It’s a worth pack to get especially if you’re getting to download it free of charge. You will without a doubt enjoy the things they’ve done with the stuff. It is possible to comment, review, and collaborate all of your work. If you want more help then whats. With all items provided here you will need to learn how to use them with each other to bring the most out of them. It’s quite boring that you find it has the identical appearance. When you’re observe the little download window on the screen click RUN, and adhere to the directions of the installer. There are a few features off. Also, few of the characteristics on the totally free Kine Master aren’t available until to pay a great chunk of money. Other available choice is that you are able to unlock below mention hidden keys and shield your PC for another 1 year. There are several premium plans readily available, with annual programs benefiting from unlimited recoveries for the full calendar year. There are several different reliable programs out there on the market that will guarantee a clean atmosphere for your system. Regardless of the different offerings from VPN providers there are a few conventional advantages that youll. Use the keygen offered to generate a serial key for installing. Download the most recent version of this software free. An easy way to recover your data. Better protection for everybody. Security Tutorials section for a number of additional guidance in security. Click the Menu button and choose Settings to observe all your choices. At any time you find some intriguing tw. You are able to download virus free data with this awesome antivirus. More so, additionally, it includes a file shredder which allows you to delete different files or folders from your computer without worrying about them ending in the incorrect hands. Spyware, worms, Trojans, rootkits, in addition to other nasty varieties of malware. As it’s an anti-malware application, it’s vital that users get the newest updates to continue to keep their computers protected. This program gives a totally free trial of the software, to help users get familiarized with the software and ascertain whether they’d require the application. Then you can readily eliminate this program. This computer software safeguards your private computer from external threat. It is very famous in the whole world. It is also available for android device. This software set up on your PC then no need to be concerned about virus and any kind of malware attack. In Pro, Antivirus have several new choices for security. In the world, lots of people utilize this antivirus consequently. As an expert antivirus have lots of new alternatives for security. You will forget different antivirus after using this tool on your computer. In the world use this, lots of people utilize this antivirus due to its result. AVG Antivirus 2018 is very easy and simple to utilize it. AVG Antivirus is among the most complete programs we’ve found thus far. The best products utilize real-time analysis to spot frauds which are too new for the blacklists. Functions on wired and companies that can be wireless. Most security product developers nowadays attracts user with different months of absolutely free usage promotional offer, then require user to pay a yearly subscription fee to keep on using the solution or maybe to get the virus signature update. Its installer is comparatively small, in comparison to those of its competitors. The security suite’s installer can be readily downloaded from several file hosting websites. During the installation procedure, users are prompted to decide on the components to be deployed on the computer system. The new user creates your account initially and then utilized this remarkable feature. You are able to insert password to guard your secret and important files. It’s possible to also change password if anybody know about doing it. The password is utilized to guard your privacy This antivirus software employed by AVG Technologies. These torrent files are extremely tiny. You’re able to quickly restore your computer files in only a couple of seconds or minutes with using this computer software.
its user base comprises of over 200 billion all around the world. it recommended anti-virus for defending all sorts of virus halt the malware attack. within this feature, anti-virus defends you from several types of hacking that are perfect for your privacy and secure data. avg anti-virus includes our special link scanner to keep you from accidentally visiting harmful websites. the antivirus solutions supplied by avg quickly made it to the top, as a result of their capacity to shield computers from the most recent threats via strong shields against spyware and internet malware. avg antivirus 2019 is among the best antiviruses for computers and cellular phones. avast provides an extremely similar feature, even though it’s installed by default in place of on first use. avg antivirus serial keys are extremely easy and simple to use. avg 2019 apk mod revdl crack is among the very best businesses that provide quality security solutions. utilize your pc even if it doesn’t get the job done. this pack will certainly enhance the outdoor setting of your dwelling. it’s a worth pack to get especially if you’re getting to download it free of charge. you will without a doubt enjoy the things they’ve done with the stuff. it is possible to comment, review, and collaborate all of your work. if you want more help then whats. with all items provided here you will need to learn how to use them with each other to bring the most out of them. it’s quite boring that you find it has the identical appearance. when you’re observe the little download window on the screen click run, and adhere to the directions of the installer. there are a few features off. also, few of the characteristics on the totally free kine master aren’t available until to pay a great chunk of money. other available choice is that you are able to unlock below mention hidden keys and shield your pc for another 1 year. there are several premium plans readily available, with annual programs benefiting from unlimited recoveries for the full calendar year. there are several different reliable programs out there on the market that will guarantee a clean atmosphere for your system. regardless of the different offerings from vpn providers there are a few conventional advantages that youll. use the keygen offered to generate a serial key for installing. download the most recent version of this software free. an easy way to recover your data. better protection for everybody. security tutorials section for a number of additional guidance in security. click the menu button and choose settings to observe all your choices. at any time you find some intriguing tw. you are able to download virus free data with this awesome antivirus. more so, additionally, it includes a file shredder which allows you to delete different files or folders from your computer without worrying about them ending in the incorrect hands. spyware, worms, trojans, rootkits, in addition to other nasty varieties of malware. as it’s an anti-malware application, it’s vital that users get the newest updates to continue to keep their computers protected. this program gives a totally free trial of the software, to help users get familiarized with the software and ascertain whether they’d require the application. then you can readily eliminate this program. this computer software safeguards your private computer from external threat. it is very famous in the whole world. it is also available for android device. this software set up on your pc then no need to be concerned about virus and any kind of malware attack. in pro, antivirus have several new choices for security. in the world, lots of people utilize this antivirus consequently. as an expert antivirus have lots of new alternatives for security. you will forget different antivirus after using this tool on your computer. in the world use this, lots of people utilize this antivirus due to its result. avg antivirus 2018 is very easy and simple to utilize it. avg antivirus is among the most complete programs we’ve found thus far. the best products utilize real-time analysis to spot frauds which are too new for the blacklists. functions on wired and companies that can be wireless. most security product developers nowadays attracts user with different months of absolutely free usage promotional offer, then require user to pay a yearly subscription fee to keep on using the solution or maybe to get the virus signature update. its installer is comparatively small, in comparison to those of its competitors. the security suite’s installer can be readily downloaded from several file hosting websites. during the installation procedure, users are prompted to decide on the components to be deployed on the computer system. the new user creates your account initially and then utilized this remarkable feature. you are able to insert password to guard your secret and important files. it’s possible to also change password if anybody know about doing it. the password is utilized to guard your privacy this antivirus software employed by avg technologies. these torrent files are extremely tiny. you’re able to quickly restore your computer files in only a couple of seconds or minutes with using this computer software.
Different from the traditional public subway passage, an integrated shared space will be directly connected to the destination while T-shape transfer system will effectively promote the development of surrounding areas to increase their value. Three branch axes corridor connecting the public green space with culture sites. The flexible mode of integrated development and cooperation will create the 4th generation of underground complex and a three-dimensional Qinhuai city for the prosperity of the ancient city. Vehicles will be allowed to enter the underground logistic center within segmented period of time in midnight.The development of underground city has gone through generations, marching towards the 4th phase, which is comprehensive urban complex.The 3rd level is used for the single entrance of the underground parking system to ensure the possibility of integrated development.Details, hits: 588, from may 30 to June 2, Almaty hosted the final tournament "Winter-spring -2018" of the National student football League among colleges of the Republic of Kazakhstan.16 best national teams of colleges from all over Kazakhstan took part in the tournament.The overall commercial axis is set beneath Dingshan Avenue, connecting to central CBD station in the north and Binjiang station in the south.We wish you new victories on the football Olympus!Nanjing Jiangbei CBD is the only state-level new area in Jiangsu Province. Successful performance in the championship was promoted both by experience of last year, and the strengthened preparation for competitions and a victory in regional tournament. Congratulations to Tuleutayev Zhasulan, Askar Beisembai, Alibek Kasymov, Adilkhas Olzhas, Tukenov Azat, Shakenov Meirlan, Libik Eugene, Gaziyev Amiran, of course, head coach Mukataev Murat Meiramovich! Nanjing Underground City design represents Nanjing urban development marching towards the 4th phase of comprehensive urban complex. The honor of our region was defended by football team of Karaganda College of actual education "Bolashak". It is the strategic fulcrum of east China towards the hinterland.Sunken plaza with a variety of traditional culture themes brings the natural daylight to the commercial space despite of the technical difficulties.With the opportunity of the development of subway, the planning of underground city should focus on sustainable concept and effective operation mode.Young, strong-willed, promising athletes play for the football team of the College.Qinhuai river connect the Confucius temple and Stone City graciously and form profound culture of ancient capital.Recall that in 2017 our team became the bronze medalist of the NSL championship.In promotionele korting easyjet the concept of integrated development, building a regional logistic center, warehousing and distribution integration will become the dominant trend in the future.Our design which is based on the Qinhuai under the city, make.3 km long underground corridor form special culture space, commercial space and communication space under the city.Underground traffic system is divided into 3 levels: the 1st level is mainly for transit traffic the tunnel across the river; the 2nd level is planned for underground transit passage and the loop for parking system to ensure the transportation of the core area. Showing a beautiful, spectacular football and showing the will to win, the guys took 2nd place, thereby improving the result of last year, beating in the semi-final Taldykorgan and losing in the final to team of Almaty. Please keep in mind: A hashtag must be written as a single word, without any spaces.For example, a hashtag like #IhateMondaysBecause gives the audience a million and one potential responses like "football season hasn't started" or "It's not Sunday." Creating this conversation is..
different from the traditional public subway passage, an integrated shared space will be directly connected to the destination while t-shape transfer system will effectively promote the development of surrounding areas to increase their value. three branch axes corridor connecting the public green space with culture sites. the flexible mode of integrated development and cooperation will create the 4th generation of underground complex and a three-dimensional qinhuai city for the prosperity of the ancient city. vehicles will be allowed to enter the underground logistic center within segmented period of time in midnight.the development of underground city has gone through generations, marching towards the 4th phase, which is comprehensive urban complex.the 3rd level is used for the single entrance of the underground parking system to ensure the possibility of integrated development.details, hits: 588, from may 30 to june 2, almaty hosted the final tournament "winter-spring -2018" of the national student football league among colleges of the republic of kazakhstan.16 best national teams of colleges from all over kazakhstan took part in the tournament.the overall commercial axis is set beneath dingshan avenue, connecting to central cbd station in the north and binjiang station in the south.we wish you new victories on the football olympus!nanjing jiangbei cbd is the only state-level new area in jiangsu province. successful performance in the championship was promoted both by experience of last year, and the strengthened preparation for competitions and a victory in regional tournament. congratulations to tuleutayev zhasulan, askar beisembai, alibek kasymov, adilkhas olzhas, tukenov azat, shakenov meirlan, libik eugene, gaziyev amiran, of course, head coach mukataev murat meiramovich! nanjing underground city design represents nanjing urban development marching towards the 4th phase of comprehensive urban complex. the honor of our region was defended by football team of karaganda college of actual education "bolashak". it is the strategic fulcrum of east china towards the hinterland.sunken plaza with a variety of traditional culture themes brings the natural daylight to the commercial space despite of the technical difficulties.with the opportunity of the development of subway, the planning of underground city should focus on sustainable concept and effective operation mode.young, strong-willed, promising athletes play for the football team of the college.qinhuai river connect the confucius temple and stone city graciously and form profound culture of ancient capital.recall that in 2017 our team became the bronze medalist of the nsl championship.in promotionele korting easyjet the concept of integrated development, building a regional logistic center, warehousing and distribution integration will become the dominant trend in the future.our design which is based on the qinhuai under the city, make.3 km long underground corridor form special culture space, commercial space and communication space under the city.underground traffic system is divided into 3 levels: the 1st level is mainly for transit traffic the tunnel across the river; the 2nd level is planned for underground transit passage and the loop for parking system to ensure the transportation of the core area. showing a beautiful, spectacular football and showing the will to win, the guys took 2nd place, thereby improving the result of last year, beating in the semi-final taldykorgan and losing in the final to team of almaty. please keep in mind: a hashtag must be written as a single word, without any spaces.for example, a hashtag like #ihatemondaysbecause gives the audience a million and one potential responses like "football season hasn't started" or "it's not sunday." creating this conversation is..
Four on the Floor was a sketch comedy series which aired on CBC Television in 1986. Consisting of only 13 episodes, the series was a showcase for The Frantics, a comedy troupe consisting of Paul Chato, Rick Green, Dan Redican and Peter Wildman. In the U.K., it aired in Channel 4’s traditional Friday night comedy slot, 10 June-2 September 1988.
four on the floor was a sketch comedy series which aired on cbc television in 1986. consisting of only 13 episodes, the series was a showcase for the frantics, a comedy troupe consisting of paul chato, rick green, dan redican and peter wildman. in the u.k., it aired in channel 4’s traditional friday night comedy slot, 10 june-2 september 1988.
Jean-Pierre de Caussade, a French Jesuit religious director and author born within the past due 17th century, is healthier recognized for his trust within the sacredness of the current second, or the "eternal now." His masterpiece, Abandonment to Divine Providence, has been celebrated through religious writers as varied as Richard Foster and Alan Watts for its skill to invoke the secret of eternity within the now--a guideline of spirituality that resonates throughout religion traditions. Accompanied by means of the probing, specialist remark of Dennis Billy, C.Ss.R., this exemplary version of de Caussade's Abandonment deals newbies to mysticism and religious path a transparent, compelling route to stepping into God's presence. Le leading dictionnaire consacré aux femmes mystiques du monde entier, de l'Antiquité à nos jours, et qui intègre des figures appartenant à toutes les traditions religieuses et hors de celles-ci. Destinée à un huge public, cette somme s'impose d'abord par le nombre et l. a. qualité des spécialistes réunis ici pour los angeles première fois pour parler du sujet. “Non esiste da un lato una piccola mistica, marginale, incompleta, nebulosa, e persino degenerata o patologica, e dall'altro una Grande Mistica, l'unica autenticamente religiosa, l. a. strada maestra che condurrebbe alla conoscenza di Dio (…) los angeles mistica selvaggia comprende, già da sola, tutta l. a. mistica. Sophiology—the philosophical and theological idea of a transcendent attractiveness turning into immanent on the planet, via nature, liturgy, prayer, and the arts—is simply now getting into its personal as a big region of research. This innovative casebook brings jointly basic resource records, poetry, and demanding articles written through a bunch of exemplary students operating in theology, philosophy, literary reports, psychology, and poetics. Shakti’s New Voice is the 1st accomplished research of Anandmurti Gurumaa, a extensively well known modern lady guru from north India identified for supplying religious teachings and track on satellite tv for pc tv and the net. in response to vast ethnographic fieldwork and religious-historical research—as good as unforeseen and extraordinary outsider touch with the guru—Angela Rudert bargains an intimate portrait of “Gurumaa” that might be of curiosity to the guru’s admirers in addition to to students.
jean-pierre de caussade, a french jesuit religious director and author born within the past due 17th century, is healthier recognized for his trust within the sacredness of the current second, or the "eternal now." his masterpiece, abandonment to divine providence, has been celebrated through religious writers as varied as richard foster and alan watts for its skill to invoke the secret of eternity within the now--a guideline of spirituality that resonates throughout religion traditions. accompanied by means of the probing, specialist remark of dennis billy, c.ss.r., this exemplary version of de caussade's abandonment deals newbies to mysticism and religious path a transparent, compelling route to stepping into god's presence. le leading dictionnaire consacré aux femmes mystiques du monde entier, de l'antiquité à nos jours, et qui intègre des figures appartenant à toutes les traditions religieuses et hors de celles-ci. destinée à un huge public, cette somme s'impose d'abord par le nombre et l. a. qualité des spécialistes réunis ici pour los angeles première fois pour parler du sujet. “non esiste da un lato una piccola mistica, marginale, incompleta, nebulosa, e persino degenerata o patologica, e dall'altro una grande mistica, l'unica autenticamente religiosa, l. a. strada maestra che condurrebbe alla conoscenza di dio (…) los angeles mistica selvaggia comprende, già da sola, tutta l. a. mistica. sophiology—the philosophical and theological idea of a transcendent attractiveness turning into immanent on the planet, via nature, liturgy, prayer, and the arts—is simply now getting into its personal as a big region of research. this innovative casebook brings jointly basic resource records, poetry, and demanding articles written through a bunch of exemplary students operating in theology, philosophy, literary reports, psychology, and poetics. shakti’s new voice is the 1st accomplished research of anandmurti gurumaa, a extensively well known modern lady guru from north india identified for supplying religious teachings and track on satellite tv for pc tv and the net. in response to vast ethnographic fieldwork and religious-historical research—as good as unforeseen and extraordinary outsider touch with the guru—angela rudert bargains an intimate portrait of “gurumaa” that might be of curiosity to the guru’s admirers in addition to to students.
Resources Center How Does Stress Affect Substance Abuse? How Does Stress Affect Substance Abuse? According to the American Psychological Association, 44 percent of American adults reported an increase in stress levels between 2006 and 2011. Stress is a normal and healthy response to triggers in the environment, body, and mind. It only becomes a problem when individuals don’t know how to correctly manage it or when stress levels become too high. Certain individuals are predisposed to having more stress in their lives. Interestingly, it is often those same groups of people who engage in substance abuse behaviors or end up addicted to drugs and alcohol. While the nature of their stress may not be the causative link between the two, there is enough evidence of a link to know stress is a related influence. In cases of mismanagement of stress, individuals may lash out when under the pressures of mounting stress that they don’t know how to dissipate. Self-medicating with drugs and alcohol often plays a big role in the lives of the overstressed. High-stress career fields are also major contributors. For example, a legal career is associated with high levels of stress. Likewise, substance abuse among attorneys is far from uncommon. Alcohol is the primary drug of choice among lawyers. This is likely because alcohol is legal and consumption of it, even on a regular basis, has come to be a socially acceptable behavior in America. A Journal of Addiction Medicine study reports 20.6 percent of attorneys analyzed fit the criteria for alcohol dependence or problematic drinking practices. Stress is thought to be a contributing factor to the high rate of depression among attorneys. Lawyers are 3.6 times more likely to suffer from depression, according to CNN. One of the biggest precipitating factors of stress is cortisol. The body produces this hormone in the adrenal glands. When there is an overproduction of cortisol, the body actually becomes more sensitive to pain. In turn, some people may reach for illicit substances or alcohol to numb their discomfort. Excess cortisol can also cause insomnia, weight gain, anxiety, and depression. All of these factors are common underlying issues in people who have substance abuse problems. In many cases though, history of stress during childhood is not a prerequisite for an inability to handle it as an adult. Some individuals may suffer from mental health disorders that make them more susceptible to feeling distressed, even with low amounts of stress that most people would find tolerable. However, the inverse of this situation can also be true. Sometimes, substance abuse is what causes stress. Most of the time, a lifestyle that involves drug or alcohol abuse also brings with it financial woes, arguments with family, pressure to keep up at work, and additional issues. This can create a perpetual cycle of stress and substance abuse. When it comes to people who can’t manage stress well, the risk of substance abuse is also high. Adults who were raised in homes where physical, verbal, emotional, or sexual abuse occurred are a prime example of this. The dysfunction present in these homes resulted in a lack of guidance that children need to understand what their feelings mean. To a child, stress feels like tension and anxiety, but they often don’t understand these words or know how to verbalize them. These children grow into adults that don’t understand how to diffuse those feelings either. Thus, the pattern of abuse often continues. The Guardian reports 30-40 percent of children who are abused will grow up to engage in abuse themselves. The same cycle of abuse is prevalent among those who are dependent on drugs or alcohol. A quarter of all children raised by parents struggling with alcohol dependence go on to develop alcoholism themselves, according to Psych Central. Research has shown that substance choice is often impacted by what the individual is dealing with. For example, someone who is struggling with anxiety will opt for depressants that may calm their nerves, while those who suffer from depression prefer uppers like cocaine and methamphetamine. People who are under large amounts of stress on a regular basis often opt for substances that are easily obtainable. Alcohol and marijuana are likely the top two choices. While substances like these may serve as a temporary fix to mitigate stress, they don’t solve problems. They don’t reduce the amount of stress in someone’s life; they just make it easier to ignore that stress. In the end, these individuals still don’t know how to manage stress without the substance. Minimizing stress levels is life is crucial to addressing an addiction. Eliminating or minimizing triggers is a big part of this. When individuals leave treatment, they need to have a low-stress environment to return to. This presents a lot of difficulty for many clients whose family members, friends, and even spouses are also abusing drugs and alcohol. Sober living facilities may be a good place for these people to live in between treatment and returning home while they find a firmer footing in recovery. A study published in the Journal of Psychoactive Drugs supported this, with six-month abstinence rates jumping from an 11 percent baseline to 68 percent at six-month and 12-month follow-ups for one sober living facility, and from a 20 percent baseline to 40 percent at six months, and to 45 percent at 12 months, at another sober living house. Support groups can be a saving grace for individuals who may not have any sober friends to speak of outside treatment. Here, they can meet likeminded people and form relationships with them that last beyond their stint in rehab. Aside from group interaction, clients should take advantage of the therapy resources available to them. While engaging in such is a strong requirement for treatment, many people make the mistake of discontinuing their therapy once they are out of rehab. Continuing with therapy afterward builds on the work done in structured rehab and helps to prevent relapse. When stress is a contributing factor to substance abuse, the focus during treatment must not solely lie in reducing stress and environmental triggers. Of course, once the client leaves treatment, they’ll be advised to avoid their old haunts and distance themselves from others who use, but they need to be equipped to handle stress in healthy ways too. No one lives a stress-free life. A Gallup poll found that four in 10 Americans reported frequent stress in their lives. Meditation has proven itself as a strong precursor to a more peaceful lifestyle, and it works wonders for people recovering from addiction and issues of mental illness. Yoga is much the same. Harvard Health Publications noted a 65 percent improvement in overall wellbeing among women who practiced yoga in attempt to better their stress levels and decrease depression and anxiety. Exercise of any kind naturally gets endorphins pumping and raises dopamine levels naturally. The Anxiety and Depression Association of Americareported only 14 percent of the population uses exercise to deal with stress. Other methods for coping with stress can be developed by the individual in conjunction with their therapist. What works for one person may not work for someone else. The key is finding a customized approach to stress management that helps the person to cope with inevitable stress, and lower overall stress levels, without turning back to substance abuse.
resources center how does stress affect substance abuse? how does stress affect substance abuse? according to the american psychological association, 44 percent of american adults reported an increase in stress levels between 2006 and 2011. stress is a normal and healthy response to triggers in the environment, body, and mind. it only becomes a problem when individuals don’t know how to correctly manage it or when stress levels become too high. certain individuals are predisposed to having more stress in their lives. interestingly, it is often those same groups of people who engage in substance abuse behaviors or end up addicted to drugs and alcohol. while the nature of their stress may not be the causative link between the two, there is enough evidence of a link to know stress is a related influence. in cases of mismanagement of stress, individuals may lash out when under the pressures of mounting stress that they don’t know how to dissipate. self-medicating with drugs and alcohol often plays a big role in the lives of the overstressed. high-stress career fields are also major contributors. for example, a legal career is associated with high levels of stress. likewise, substance abuse among attorneys is far from uncommon. alcohol is the primary drug of choice among lawyers. this is likely because alcohol is legal and consumption of it, even on a regular basis, has come to be a socially acceptable behavior in america. a journal of addiction medicine study reports 20.6 percent of attorneys analyzed fit the criteria for alcohol dependence or problematic drinking practices. stress is thought to be a contributing factor to the high rate of depression among attorneys. lawyers are 3.6 times more likely to suffer from depression, according to cnn. one of the biggest precipitating factors of stress is cortisol. the body produces this hormone in the adrenal glands. when there is an overproduction of cortisol, the body actually becomes more sensitive to pain. in turn, some people may reach for illicit substances or alcohol to numb their discomfort. excess cortisol can also cause insomnia, weight gain, anxiety, and depression. all of these factors are common underlying issues in people who have substance abuse problems. in many cases though, history of stress during childhood is not a prerequisite for an inability to handle it as an adult. some individuals may suffer from mental health disorders that make them more susceptible to feeling distressed, even with low amounts of stress that most people would find tolerable. however, the inverse of this situation can also be true. sometimes, substance abuse is what causes stress. most of the time, a lifestyle that involves drug or alcohol abuse also brings with it financial woes, arguments with family, pressure to keep up at work, and additional issues. this can create a perpetual cycle of stress and substance abuse. when it comes to people who can’t manage stress well, the risk of substance abuse is also high. adults who were raised in homes where physical, verbal, emotional, or sexual abuse occurred are a prime example of this. the dysfunction present in these homes resulted in a lack of guidance that children need to understand what their feelings mean. to a child, stress feels like tension and anxiety, but they often don’t understand these words or know how to verbalize them. these children grow into adults that don’t understand how to diffuse those feelings either. thus, the pattern of abuse often continues. the guardian reports 30-40 percent of children who are abused will grow up to engage in abuse themselves. the same cycle of abuse is prevalent among those who are dependent on drugs or alcohol. a quarter of all children raised by parents struggling with alcohol dependence go on to develop alcoholism themselves, according to psych central. research has shown that substance choice is often impacted by what the individual is dealing with. for example, someone who is struggling with anxiety will opt for depressants that may calm their nerves, while those who suffer from depression prefer uppers like cocaine and methamphetamine. people who are under large amounts of stress on a regular basis often opt for substances that are easily obtainable. alcohol and marijuana are likely the top two choices. while substances like these may serve as a temporary fix to mitigate stress, they don’t solve problems. they don’t reduce the amount of stress in someone’s life; they just make it easier to ignore that stress. in the end, these individuals still don’t know how to manage stress without the substance. minimizing stress levels is life is crucial to addressing an addiction. eliminating or minimizing triggers is a big part of this. when individuals leave treatment, they need to have a low-stress environment to return to. this presents a lot of difficulty for many clients whose family members, friends, and even spouses are also abusing drugs and alcohol. sober living facilities may be a good place for these people to live in between treatment and returning home while they find a firmer footing in recovery. a study published in the journal of psychoactive drugs supported this, with six-month abstinence rates jumping from an 11 percent baseline to 68 percent at six-month and 12-month follow-ups for one sober living facility, and from a 20 percent baseline to 40 percent at six months, and to 45 percent at 12 months, at another sober living house. support groups can be a saving grace for individuals who may not have any sober friends to speak of outside treatment. here, they can meet likeminded people and form relationships with them that last beyond their stint in rehab. aside from group interaction, clients should take advantage of the therapy resources available to them. while engaging in such is a strong requirement for treatment, many people make the mistake of discontinuing their therapy once they are out of rehab. continuing with therapy afterward builds on the work done in structured rehab and helps to prevent relapse. when stress is a contributing factor to substance abuse, the focus during treatment must not solely lie in reducing stress and environmental triggers. of course, once the client leaves treatment, they’ll be advised to avoid their old haunts and distance themselves from others who use, but they need to be equipped to handle stress in healthy ways too. no one lives a stress-free life. a gallup poll found that four in 10 americans reported frequent stress in their lives. meditation has proven itself as a strong precursor to a more peaceful lifestyle, and it works wonders for people recovering from addiction and issues of mental illness. yoga is much the same. harvard health publications noted a 65 percent improvement in overall wellbeing among women who practiced yoga in attempt to better their stress levels and decrease depression and anxiety. exercise of any kind naturally gets endorphins pumping and raises dopamine levels naturally. the anxiety and depression association of americareported only 14 percent of the population uses exercise to deal with stress. other methods for coping with stress can be developed by the individual in conjunction with their therapist. what works for one person may not work for someone else. the key is finding a customized approach to stress management that helps the person to cope with inevitable stress, and lower overall stress levels, without turning back to substance abuse.
Juls has released his highly anticipated 5-track Ep titled Ojekoo . The EP has notable collaborations with Ghanaian and Nigerian acts like Bisa Kdei, Adekunle Gold, Tay Iwar, Moelogo, Nonso Amadi, Burna Boy, DJ Tunez just to mention a few. See track list below and cop the EP from digital stores.
juls has released his highly anticipated 5-track ep titled ojekoo . the ep has notable collaborations with ghanaian and nigerian acts like bisa kdei, adekunle gold, tay iwar, moelogo, nonso amadi, burna boy, dj tunez just to mention a few. see track list below and cop the ep from digital stores.
Capricorn: Cat, or any costume that can be easily made with just one accessory. You don’t waste your energy on shopping or DIYing an elaborate Halloween costume. You’re all about ease and practicality. The next morning, I awoke to find Eagan gone. I ran through all the bedrooms, I ran outside to look around—nothing. It was like he vanished out of thin air. There are no special effects in the movie. “Stabbing” sounds were made by knifing a watermelon. If you know someone who needs a good education in the history of horror movies, tell them to tune in.
capricorn: cat, or any costume that can be easily made with just one accessory. you don’t waste your energy on shopping or diying an elaborate halloween costume. you’re all about ease and practicality. the next morning, i awoke to find eagan gone. i ran through all the bedrooms, i ran outside to look around—nothing. it was like he vanished out of thin air. there are no special effects in the movie. “stabbing” sounds were made by knifing a watermelon. if you know someone who needs a good education in the history of horror movies, tell them to tune in.
My wife and I just finished a 2 week road trip with her 3 sisters. It was awesome! In a rented van, we tried to hit as many of the West Coast’s national parks as possible. Some of our notable stops included: Joshua Tree, Zion, Grand Canyon, Bryce, Capitol Reef, Arches, Grand Tetons, and Yellowstone. That’s not even counting the state parks and BLM land that we stopped at along the way. Throughout the two weeks, we spent a total of $17 on campsites. That’s $12 for a campsite at Goblin Valley, because we really wanted showers; and $5 for a campsite in the LaSal national forest near Arches (because it was right next to the beautiful Oowah Lake). Honestly, the best campsites we found on our trip were completely free! I decided to write this post because I wanted to help thrifty campers (like you) experience our country’s national parks as cheaply as possible! Because here’s the great news: YOU CAN FIND FREE CAMPING NEAR EVERY NATIONAL PARK (Or at least near every national park I’ve ever been to). Maplets – This costs $2.99 but has thousand of maps that are GPS-enabled. It’s a great way to find national forest info or national park info. US Public Lands – This also costs $2.99, but it provides maps of all the different public lands that are available in a given area. Super helpful! These are two of my favorite apps for finding free campsites, but I’m sure there are more out there. The important thing in finding free campsites is to DO YOUR RESEARCH and start your trip prepared. Often, there isn’t great service around national parks so it pays to already have maps downloaded on your phone. Once you find a convenient section of public land, it’s important to learn the rules. These public lands only exist because previous generations have been respectful and followed the rules. Make sure you do the same. BLM Rules – These are the general rules, but make sure to contact local BLM offices to confirm. Additionally, make sure to follow any signs that are posted in specific areas. National Forest Rules – Each national forest will have its own set of rules. Make sure to stop by a ranger station or do some online research to learn about the rules in each particular forest. Dispersed camping is awesome! I don’t know about you, but I love getting to spend the night in beautiful location with no one around for miles. I love staring up at the stars and seeing the Milky Way because there’s no light pollution. I love drinking low-quality instant coffee and watching a beautiful sunrise. All of this is made even sweeter by the fact that it’s free. BUUUUTTTT….we have to be respectful of these beautiful places! I’ll say it again. BE RESPECTFUL!!! During our last trip, we got to see the solar eclipse at the Grand Tetons National Park. It. Was. Unreal. Seriously, one of the coolest experiences of my life! The night after the eclipse, we were camping just outside the Grand Tetons in the Bridger-Teton national forest. Bridget-Teton is a beautiful national forest, and most of the dispersed campers we met were very respectful and responsible. There was one group of campers at the Grand Tetons (that I am ashamed to say were from my generation) who were not respectful at all. There were signs posted everywhere saying not to have fires because there was significant fire danger. Anyway, that’s the end of my rant. It’s just frustrating to see people not only being disrespectful and rude, but also being very unsafe! Please don’t be that person. Pick up after yourself and make sure to leave no trace when you freedom camp. For more information on camping etiquette, check out this post.
my wife and i just finished a 2 week road trip with her 3 sisters. it was awesome! in a rented van, we tried to hit as many of the west coast’s national parks as possible. some of our notable stops included: joshua tree, zion, grand canyon, bryce, capitol reef, arches, grand tetons, and yellowstone. that’s not even counting the state parks and blm land that we stopped at along the way. throughout the two weeks, we spent a total of $17 on campsites. that’s $12 for a campsite at goblin valley, because we really wanted showers; and $5 for a campsite in the lasal national forest near arches (because it was right next to the beautiful oowah lake). honestly, the best campsites we found on our trip were completely free! i decided to write this post because i wanted to help thrifty campers (like you) experience our country’s national parks as cheaply as possible! because here’s the great news: you can find free camping near every national park (or at least near every national park i’ve ever been to). maplets – this costs $2.99 but has thousand of maps that are gps-enabled. it’s a great way to find national forest info or national park info. us public lands – this also costs $2.99, but it provides maps of all the different public lands that are available in a given area. super helpful! these are two of my favorite apps for finding free campsites, but i’m sure there are more out there. the important thing in finding free campsites is to do your research and start your trip prepared. often, there isn’t great service around national parks so it pays to already have maps downloaded on your phone. once you find a convenient section of public land, it’s important to learn the rules. these public lands only exist because previous generations have been respectful and followed the rules. make sure you do the same. blm rules – these are the general rules, but make sure to contact local blm offices to confirm. additionally, make sure to follow any signs that are posted in specific areas. national forest rules – each national forest will have its own set of rules. make sure to stop by a ranger station or do some online research to learn about the rules in each particular forest. dispersed camping is awesome! i don’t know about you, but i love getting to spend the night in beautiful location with no one around for miles. i love staring up at the stars and seeing the milky way because there’s no light pollution. i love drinking low-quality instant coffee and watching a beautiful sunrise. all of this is made even sweeter by the fact that it’s free. buuuutttt….we have to be respectful of these beautiful places! i’ll say it again. be respectful!!! during our last trip, we got to see the solar eclipse at the grand tetons national park. it. was. unreal. seriously, one of the coolest experiences of my life! the night after the eclipse, we were camping just outside the grand tetons in the bridger-teton national forest. bridget-teton is a beautiful national forest, and most of the dispersed campers we met were very respectful and responsible. there was one group of campers at the grand tetons (that i am ashamed to say were from my generation) who were not respectful at all. there were signs posted everywhere saying not to have fires because there was significant fire danger. anyway, that’s the end of my rant. it’s just frustrating to see people not only being disrespectful and rude, but also being very unsafe! please don’t be that person. pick up after yourself and make sure to leave no trace when you freedom camp. for more information on camping etiquette, check out this post.
Shop to build a better world! UNICEF Market's Hand Woven Handbag Collection helps UNICEF save and protect the world's most vulnerable children. Every gift you purchase helps save children's lives.
shop to build a better world! unicef market's hand woven handbag collection helps unicef save and protect the world's most vulnerable children. every gift you purchase helps save children's lives.
This redevelopment site is located right on Nicollet Mall in the heart of downtown Minneapolis. It currently comprises four parcels on 10th Street between Nicollet and Marquette, including the historic Handicraft Guild Building. The remaining parcels are planned to form the site of a significant new construction project that is currently in the planning stages.
this redevelopment site is located right on nicollet mall in the heart of downtown minneapolis. it currently comprises four parcels on 10th street between nicollet and marquette, including the historic handicraft guild building. the remaining parcels are planned to form the site of a significant new construction project that is currently in the planning stages.
On 14 December 2017, the United States Federal Communications Commission ("FCC") voted to repeal the net neutrality regulations set in place during the Obama administration in 2015 ("2015 Regulations"). Net neutrality generally refers to network providers treating all sources of Internet content equally as well as consumers’ rights to access content and services on the Internet on a non-discriminatory basis. Generally, this means that Internet Service Providers ("ISPs") should not be allowed to block legal content of a consumer’s choice, throttle legal internet traffic to slower speeds or sell “fast lane” services to content providers who can pay more than others. Effectively, net neutrality seemingly creates a more level playing field for businesses. This Update provides a summary of the changes to the United States' position on net neutrality, followed by our comments on the potential impact of the FCC decision to the net neutrality policies in certain parts of South-East Asia.
on 14 december 2017, the united states federal communications commission ("fcc") voted to repeal the net neutrality regulations set in place during the obama administration in 2015 ("2015 regulations"). net neutrality generally refers to network providers treating all sources of internet content equally as well as consumers’ rights to access content and services on the internet on a non-discriminatory basis. generally, this means that internet service providers ("isps") should not be allowed to block legal content of a consumer’s choice, throttle legal internet traffic to slower speeds or sell “fast lane” services to content providers who can pay more than others. effectively, net neutrality seemingly creates a more level playing field for businesses. this update provides a summary of the changes to the united states' position on net neutrality, followed by our comments on the potential impact of the fcc decision to the net neutrality policies in certain parts of south-east asia.
This role will offer flexible/home working and the potential of a long term role with deliverables running into 2022. The programme is designed to provide a modern working environment across multiple large offices including the implementation of a flexible, agile working strategy. Candidates also need to have prior experience providing business and data analysis for large FS organisations. In addition, knowledge of general banking compliance is required. Please note this is not an IT/Infrastructure role, candidates must have previous Business or Data Analysis experience and any exposure to property moves, relocations or modernisations. Any experience of cultural change or people change as a result of changes in the workplace would be a bonus. If you are interested in the position or would like further information, please contact Kat Goulding on 01204 699008.
this role will offer flexible/home working and the potential of a long term role with deliverables running into 2022. the programme is designed to provide a modern working environment across multiple large offices including the implementation of a flexible, agile working strategy. candidates also need to have prior experience providing business and data analysis for large fs organisations. in addition, knowledge of general banking compliance is required. please note this is not an it/infrastructure role, candidates must have previous business or data analysis experience and any exposure to property moves, relocations or modernisations. any experience of cultural change or people change as a result of changes in the workplace would be a bonus. if you are interested in the position or would like further information, please contact kat goulding on 01204 699008.
Think that internal branding is only important to your employees? It can also impact the rest of your business -- including recuriting efforts and even your bottom line. Cause branding has become intergral to a business' strategy. Learn how to engage in cause branding, what fators to consider, as well as what to avoid when implementing your strategy. Data science can help brands drive meaningful change. Find out how a statistical modeling framework can help connect the dots, make informed decisions and outperform competitors. The California Consumer Privacy Act was signed into law on September 23, 2018. Discover how this affects organizations that do business and handle consumer data within the state. Discover the method you can use to quantify the worth of your target firm's brand ahead of any potential merger or acquisition. Capturing this insight can help you make informed decisions that align with your business strategy. Google is prioritizing websites in search rankings that are optimized for mobile devices. Find out how to ensure your site is mobile-friendly and meets user and search engine needs at the same time. Financial impact analysis (FIAs) models play a crucial role in your ability to demonstrate the worth of your product or service and more. Learn how FIAs can drive business performance for you and your buyers. How Do You Map the Value Chain? Discover how to map your value chain and surface important business insight with our high-level framework. From setting up the project team to documenting the delivery cycle, we cover essential steps that can help you deliver on your brand promise. Roughly one-in-eight people in the U.S. have a disability. Failure to accommodate such a large audience limits the positive impact a website can have on your business. Learn how you can make your websites accessible to everyone. In the wake of increasing M&A activity, potential acquirers need to ensure target firms can deliver strong returns. Discover how measuring brand value can accelerate your growth strategy. The EU's General Data Protection Regulation (GDPR) won't only affect member states but also U.S. companies that do business in Europe. So what do we need to know and do about being GDPR compliant? Is your website actually engaging and converting prospects at a rate that reflects your business goals? Discover the layers that make up high performing business websites. Websites are under greater threat from hacking than ever before. As vulnerabilities continue to be exploited, we take a look at how you can optimize the security of your CMS and remain proactive. Discover how real companies documented their processes, uncovered unique insight and improved business performance. As buyers gain influence, companies are turning to branding to differentiate themselves in the marketplace. Discover how a strong brand drives real business growth. Websites across the internet will be affected by Google Chrome's security warning updates coming in October 2017. Learn more about Google's update from our SAM expert. Read how Houston-based adoption agency, Spaulding for Children, decided to rebrand as Arms Wide Adoption Services. Learn how data-science impacted a mid-sized pipeline company's strategic areas of focus. Learn the steps to creating unique, valuable content that not only aligns with your brand identity, but earns shares among your target audience. Read our tips to help your business remain true to your brand through every economic phase. Learn how to keep your sales playbooks and sales training program aligned with your brand identity. Develop a stronger account-based marketing and marketing automation program. Learn how to tie your MAP and ABM programs into your overall sales strategy. Develop a content strategy your marketing and sales teams can use. Get tips to help your teams work together, communicate effectively and leverage content. Learn B2B digital marketing strategies you can apply to your own brand. See real examples from clients and get tips to determine if a similar approach will work for you. Develop a marketing plan that drives greater ROI. Get tips to help your team stay accountable, complete planned activities and reset if necessary. Get guidance to lead a rebrand after an acquisition, merger or other major business turning point. Gain insight from a company who successfully relaunched. Explore brands we've developed for top law firms like Fulbright, BoyarMiller and more. See how the right brand identity supported their success. Join us as we look back on the brands and logos we have created over the past 10 years for the non-profit organizations that help our community thrive. Our digital experts explain what Google’s update really means for your business' digital strategy and how to adjust to a mobile-first landscape. The BrandExtract C-Suite reveals the worst branding mistakes you can make in a downturn – and the opportunities you should seize immediately. Discover why we read and discuss books as a company, as well as how we select our books and lead discussions. See what we're reading. Learn how to assess your marketing or branding ROI by designing an experiment and running strategic tests – all while building the value of your business. Brand consistency builds company value, reinforces your market position and attracts better quality customers. Learn strategies to assess and strengthen your brand. From building brand awareness to transferring brand equity during a divestiture, our BE Co-Founders answer seven of our most frequently asked questions. A rebrand creates meaningful change in an organization by aligning marketplace perceptions, improving processes, and increasing stakeholder ownership. What do you do when you experience a drop in sales? How do you react when growth outpaces your predictions? Both could be a reason to reevaluate your brand. BrandExtract Senior Designer, Abbey Mora partnered with Houston’s up-and-coming creative talent as a mentor in AIGA’s Design Loop 2014 program.
think that internal branding is only important to your employees? it can also impact the rest of your business -- including recuriting efforts and even your bottom line. cause branding has become intergral to a business' strategy. learn how to engage in cause branding, what fators to consider, as well as what to avoid when implementing your strategy. data science can help brands drive meaningful change. find out how a statistical modeling framework can help connect the dots, make informed decisions and outperform competitors. the california consumer privacy act was signed into law on september 23, 2018. discover how this affects organizations that do business and handle consumer data within the state. discover the method you can use to quantify the worth of your target firm's brand ahead of any potential merger or acquisition. capturing this insight can help you make informed decisions that align with your business strategy. google is prioritizing websites in search rankings that are optimized for mobile devices. find out how to ensure your site is mobile-friendly and meets user and search engine needs at the same time. financial impact analysis (fias) models play a crucial role in your ability to demonstrate the worth of your product or service and more. learn how fias can drive business performance for you and your buyers. how do you map the value chain? discover how to map your value chain and surface important business insight with our high-level framework. from setting up the project team to documenting the delivery cycle, we cover essential steps that can help you deliver on your brand promise. roughly one-in-eight people in the u.s. have a disability. failure to accommodate such a large audience limits the positive impact a website can have on your business. learn how you can make your websites accessible to everyone. in the wake of increasing m&a activity, potential acquirers need to ensure target firms can deliver strong returns. discover how measuring brand value can accelerate your growth strategy. the eu's general data protection regulation (gdpr) won't only affect member states but also u.s. companies that do business in europe. so what do we need to know and do about being gdpr compliant? is your website actually engaging and converting prospects at a rate that reflects your business goals? discover the layers that make up high performing business websites. websites are under greater threat from hacking than ever before. as vulnerabilities continue to be exploited, we take a look at how you can optimize the security of your cms and remain proactive. discover how real companies documented their processes, uncovered unique insight and improved business performance. as buyers gain influence, companies are turning to branding to differentiate themselves in the marketplace. discover how a strong brand drives real business growth. websites across the internet will be affected by google chrome's security warning updates coming in october 2017. learn more about google's update from our sam expert. read how houston-based adoption agency, spaulding for children, decided to rebrand as arms wide adoption services. learn how data-science impacted a mid-sized pipeline company's strategic areas of focus. learn the steps to creating unique, valuable content that not only aligns with your brand identity, but earns shares among your target audience. read our tips to help your business remain true to your brand through every economic phase. learn how to keep your sales playbooks and sales training program aligned with your brand identity. develop a stronger account-based marketing and marketing automation program. learn how to tie your map and abm programs into your overall sales strategy. develop a content strategy your marketing and sales teams can use. get tips to help your teams work together, communicate effectively and leverage content. learn b2b digital marketing strategies you can apply to your own brand. see real examples from clients and get tips to determine if a similar approach will work for you. develop a marketing plan that drives greater roi. get tips to help your team stay accountable, complete planned activities and reset if necessary. get guidance to lead a rebrand after an acquisition, merger or other major business turning point. gain insight from a company who successfully relaunched. explore brands we've developed for top law firms like fulbright, boyarmiller and more. see how the right brand identity supported their success. join us as we look back on the brands and logos we have created over the past 10 years for the non-profit organizations that help our community thrive. our digital experts explain what google’s update really means for your business' digital strategy and how to adjust to a mobile-first landscape. the brandextract c-suite reveals the worst branding mistakes you can make in a downturn – and the opportunities you should seize immediately. discover why we read and discuss books as a company, as well as how we select our books and lead discussions. see what we're reading. learn how to assess your marketing or branding roi by designing an experiment and running strategic tests – all while building the value of your business. brand consistency builds company value, reinforces your market position and attracts better quality customers. learn strategies to assess and strengthen your brand. from building brand awareness to transferring brand equity during a divestiture, our be co-founders answer seven of our most frequently asked questions. a rebrand creates meaningful change in an organization by aligning marketplace perceptions, improving processes, and increasing stakeholder ownership. what do you do when you experience a drop in sales? how do you react when growth outpaces your predictions? both could be a reason to reevaluate your brand. brandextract senior designer, abbey mora partnered with houston’s up-and-coming creative talent as a mentor in aiga’s design loop 2014 program.
You can have confidence in Asbestos Shingle Guys to offer the best solutions for Asbestos Shingles in Hartford, WI. Our crew of highly skilled experts can offer the services that you require with the most sophisticated technology in the industry. Our supplies are of the highest quality and we have learned to help save you costs. Call us today at 800-338-0047 and we'll be happy to go over your alternatives, reply to the questions you have, and set up a consultation to commence preparing your task. Economizing is a valuable part of your process. Still you need to have top standard services for Asbestos Shingles in Hartford, WI, and you can trust us to conserve your funds while continually giving the top quality services. We guarantee that our money conserving initiatives don't ever translate to a lesser level of excellence. Our aim is to be certain that you experience the best quality supplies and a result which endures over time. We'll do that by offering you the very best savings available and preventing costly complications. If you'd like to reduce costs, Asbestos Shingle Guys is the business to call. Call 800-338-0047 to speak with our client care staff, now. Concerning Asbestos Shingles in Hartford, WI, you have to be knowledgeable to make the most effective judgments. You should not go in without knowing it properly, and it is best to know what you should expect. That's the reason we try to make every effort to make sure that you understand the strategy and are not confronted by any sort of unexpected surprises. Begin by calling 800-338-0047 to discuss your project. We will explore your concerns and questions once you give us a call and get you organized with a scheduled appointment. Our staff will show up at the arranged time with all the necessary resources, and can work closely with you during the entire process. You've got a lot of reasons to turn to Asbestos Shingle Guys for your needs regarding Asbestos Shingles in Hartford, WI. Our products are of the very best quality, our money saving practices are sensible and effective, and our customer satisfaction scores can't be beat. Our company has the skills you will want to fulfill all your objectives. Dial 800-338-0047 to connect with Asbestos Shingle Guys and consider your needs concerning Asbestos Shingles in Hartford.
you can have confidence in asbestos shingle guys to offer the best solutions for asbestos shingles in hartford, wi. our crew of highly skilled experts can offer the services that you require with the most sophisticated technology in the industry. our supplies are of the highest quality and we have learned to help save you costs. call us today at 800-338-0047 and we'll be happy to go over your alternatives, reply to the questions you have, and set up a consultation to commence preparing your task. economizing is a valuable part of your process. still you need to have top standard services for asbestos shingles in hartford, wi, and you can trust us to conserve your funds while continually giving the top quality services. we guarantee that our money conserving initiatives don't ever translate to a lesser level of excellence. our aim is to be certain that you experience the best quality supplies and a result which endures over time. we'll do that by offering you the very best savings available and preventing costly complications. if you'd like to reduce costs, asbestos shingle guys is the business to call. call 800-338-0047 to speak with our client care staff, now. concerning asbestos shingles in hartford, wi, you have to be knowledgeable to make the most effective judgments. you should not go in without knowing it properly, and it is best to know what you should expect. that's the reason we try to make every effort to make sure that you understand the strategy and are not confronted by any sort of unexpected surprises. begin by calling 800-338-0047 to discuss your project. we will explore your concerns and questions once you give us a call and get you organized with a scheduled appointment. our staff will show up at the arranged time with all the necessary resources, and can work closely with you during the entire process. you've got a lot of reasons to turn to asbestos shingle guys for your needs regarding asbestos shingles in hartford, wi. our products are of the very best quality, our money saving practices are sensible and effective, and our customer satisfaction scores can't be beat. our company has the skills you will want to fulfill all your objectives. dial 800-338-0047 to connect with asbestos shingle guys and consider your needs concerning asbestos shingles in hartford.
NEW ORLEANS - The federal government will hold five public meetings around the Gulf Coast to get comments about air quality modeling and analysis for proposed region-wide oil lease sales next year. The Bureau of Ocean Energy management says the modeling results have not yet been reviewed. The open house-style meetings April 25 through May 1 also will take comments on other aspects of a draft environmental impact statement . They'll run from 4 p.m. to 7 p.m. on April 25 outside New Orleans, April 27 in Houston, May 1 in Pensacola, Florida; May 2 in Mobile, Alabama; and May 3 in Gulfport, Mississippi. Comments may also be mailed to the Bureau of Ocean Energy Management or sent through the regulations.gov web portal, under Docket No. BOEM-2017-0001. The 45-day comment period ends May 15.
new orleans - the federal government will hold five public meetings around the gulf coast to get comments about air quality modeling and analysis for proposed region-wide oil lease sales next year. the bureau of ocean energy management says the modeling results have not yet been reviewed. the open house-style meetings april 25 through may 1 also will take comments on other aspects of a draft environmental impact statement . they'll run from 4 p.m. to 7 p.m. on april 25 outside new orleans, april 27 in houston, may 1 in pensacola, florida; may 2 in mobile, alabama; and may 3 in gulfport, mississippi. comments may also be mailed to the bureau of ocean energy management or sent through the regulations.gov web portal, under docket no. boem-2017-0001. the 45-day comment period ends may 15.
Admittedly, I’m not usually so organised with my Christmas shopping, tending to frantically order all of my presents online a couple of weeks before and then panic that they won’t arrive in time. However, with my due date three weeks away, and with the luxury of being on maternity leave, I’m planning to have it all wrapped up (see what I did there?) in the next couple of weeks. I realise that not everyone has this pleasure of time (as I soon won’t!), so I’ve put together a gallery of my best finds from the high street so far that will make perfect Christmas stocking fillers this year. With stores becoming evermore competitive and with the likes of value stores such as Primark keeping their finger firmly on the trends pulse, there really are some great items out there – so you can fill those stockings up to the brim without breaking the bank! What would you like in your Christmas stocking this year?
admittedly, i’m not usually so organised with my christmas shopping, tending to frantically order all of my presents online a couple of weeks before and then panic that they won’t arrive in time. however, with my due date three weeks away, and with the luxury of being on maternity leave, i’m planning to have it all wrapped up (see what i did there?) in the next couple of weeks. i realise that not everyone has this pleasure of time (as i soon won’t!), so i’ve put together a gallery of my best finds from the high street so far that will make perfect christmas stocking fillers this year. with stores becoming evermore competitive and with the likes of value stores such as primark keeping their finger firmly on the trends pulse, there really are some great items out there – so you can fill those stockings up to the brim without breaking the bank! what would you like in your christmas stocking this year?
Markets likely to open flat. Support for Nifty is at 10450 and resistance at 10620. Bank Nifty has support at 25200 and resistance at 25550. Hi Monisha, good morning. Infibeam above 55 can test 58. triveni around 50. Sir, eicher @677, hold for sometime or sell rite away? Dear Sir, your vies on Adani Power pls. Do you think it is likely to reach 52 week high? when? Hi cb , can i buy nifty options11000 CE for oct series. Hi Vijay Vengurlekar, it has resistance at 37-38 levels. possible consolidates here before moving higher. Any chance for going 570 tomorrow ? Hi Anbu, can test 303-305.
markets likely to open flat. support for nifty is at 10450 and resistance at 10620. bank nifty has support at 25200 and resistance at 25550. hi monisha, good morning. infibeam above 55 can test 58. triveni around 50. sir, eicher @677, hold for sometime or sell rite away? dear sir, your vies on adani power pls. do you think it is likely to reach 52 week high? when? hi cb , can i buy nifty options11000 ce for oct series. hi vijay vengurlekar, it has resistance at 37-38 levels. possible consolidates here before moving higher. any chance for going 570 tomorrow ? hi anbu, can test 303-305.
You visited the company's web page Smartstyle. The company is located in the state Alabama, the city of Boaz. The legal address of our company is 1972 USHighway 431 Boaz, AL 35957. For more information, please call (256) 593-1192.
you visited the company's web page smartstyle. the company is located in the state alabama, the city of boaz. the legal address of our company is 1972 ushighway 431 boaz, al 35957. for more information, please call (256) 593-1192.
BA 6145 is a transparent double-sided self-adhesive tape consisting of a PET backing and a modified acrylic adhesive. It offers a reliable bond even to low surface energy substrates and is immediately usable after assembly. BA 6145 is suitable for the most demanding applications such as heavy stress, high temperatures and critical substrates.
ba 6145 is a transparent double-sided self-adhesive tape consisting of a pet backing and a modified acrylic adhesive. it offers a reliable bond even to low surface energy substrates and is immediately usable after assembly. ba 6145 is suitable for the most demanding applications such as heavy stress, high temperatures and critical substrates.
The Quest of Yam — A demo of my first attempt at game making. A platformer with interesting gravity mechanics. ← I spent too much money on video games this year. MAZEBOT – First public playable. Call for feedback!
the quest of yam — a demo of my first attempt at game making. a platformer with interesting gravity mechanics. ← i spent too much money on video games this year. mazebot – first public playable. call for feedback!
This blog is a work in progress, just like me! Hooray, I have a website- with a blog, no less. The first blog post is always a little bit intimidating. What do I write about? What tone will it be setting for the blog posts to come? Am I putting way too much thought into the first blog post? Probably, yes. I decided to just get it over with and say namaste, friend. Welcome to my little corner of the internet. I hope you don't get lost in my rantings, I hope you find something that inspires you, something that makes you think, something that makes you smile. We can learn something from everyone, after all. I can't promise that my posts will be interesting or 100% yoga related ( can actually guarantee that much) but I can promise you that they will be authentically me. I never was good at trying to be anyone but myself. I learned long ago that unless I was being myself, my weird, foul-mouthed, hyperactive, whimsical, awkward, space-case self, it didn't work for anyone. So, be warned, qui legit emptor ( that was my rough translation of reader beware). You will find madness, whimsy, insight, and truth here.
this blog is a work in progress, just like me! hooray, i have a website- with a blog, no less. the first blog post is always a little bit intimidating. what do i write about? what tone will it be setting for the blog posts to come? am i putting way too much thought into the first blog post? probably, yes. i decided to just get it over with and say namaste, friend. welcome to my little corner of the internet. i hope you don't get lost in my rantings, i hope you find something that inspires you, something that makes you think, something that makes you smile. we can learn something from everyone, after all. i can't promise that my posts will be interesting or 100% yoga related ( can actually guarantee that much) but i can promise you that they will be authentically me. i never was good at trying to be anyone but myself. i learned long ago that unless i was being myself, my weird, foul-mouthed, hyperactive, whimsical, awkward, space-case self, it didn't work for anyone. so, be warned, qui legit emptor ( that was my rough translation of reader beware). you will find madness, whimsy, insight, and truth here.
It’s important to know the range and diversity of languages spoken in a country so that appropriate translations such as those involved with medical document translation and equipment can be conducted to keep the public properly informed. ● In the New York metropolitan area, 192 different languages are spoken in homes. 38% of the age 5 and over age group speak at least another language apart from English in the home. ● In the Los Angeles metropolitan area, no less than 185 languages are spoken in homes. 54% of those aged 5 years and over are able to speak a language apart from English while at home. ● In the Chicago metropolitan area, 153 languages can be found spoken at home. 29% of the metropolitan area of age 5 years old and more speak one other language apart from English while at home. ● In the Miami metropolitan area, no less than 128 languages are spoken at home. 51% of the metro area population age 5 and over speak a language other than English at home. ● In the Atlanta metropolitan area around 146 languages can be found spoken at home. 17 percent of those of those over the age of 5 speak one other language besides English in the home. ● In the Seattle metropolitan area approximately 166 languages can be heard spoken in the home while 22% of those aged 5 and above speak one other language besides English. Language barriers can turn out to be massive stumbling blocks when a person needs medical care. To ensure the multiplicity of languages is covered, Section 1557 of the 2010 Affordable Care Act was passed. This prohibits discrimination for any reason whatsoever for not being included in health programs and other activities that are provided by the Department of Health and Human Service on the basis of language. It also emphasizes the importance of utilizing language translation services so that providing substandard care because of language barriers can be avoided at all costs. Medical treatment providers have a great source of language translators that can be accessed to meet the needs of their limited English clients. There are linguists available in more than 350 languages using on-demand services via Video Remote Interpretation (VRI) and Over the Phone Interpretation (OPI). It’s possible to even connect with an interpreter in a named language within several minutes of submitting a request. There is no excuse to provide a poor service to those who don’t have good spoken English.
it’s important to know the range and diversity of languages spoken in a country so that appropriate translations such as those involved with medical document translation and equipment can be conducted to keep the public properly informed. ● in the new york metropolitan area, 192 different languages are spoken in homes. 38% of the age 5 and over age group speak at least another language apart from english in the home. ● in the los angeles metropolitan area, no less than 185 languages are spoken in homes. 54% of those aged 5 years and over are able to speak a language apart from english while at home. ● in the chicago metropolitan area, 153 languages can be found spoken at home. 29% of the metropolitan area of age 5 years old and more speak one other language apart from english while at home. ● in the miami metropolitan area, no less than 128 languages are spoken at home. 51% of the metro area population age 5 and over speak a language other than english at home. ● in the atlanta metropolitan area around 146 languages can be found spoken at home. 17 percent of those of those over the age of 5 speak one other language besides english in the home. ● in the seattle metropolitan area approximately 166 languages can be heard spoken in the home while 22% of those aged 5 and above speak one other language besides english. language barriers can turn out to be massive stumbling blocks when a person needs medical care. to ensure the multiplicity of languages is covered, section 1557 of the 2010 affordable care act was passed. this prohibits discrimination for any reason whatsoever for not being included in health programs and other activities that are provided by the department of health and human service on the basis of language. it also emphasizes the importance of utilizing language translation services so that providing substandard care because of language barriers can be avoided at all costs. medical treatment providers have a great source of language translators that can be accessed to meet the needs of their limited english clients. there are linguists available in more than 350 languages using on-demand services via video remote interpretation (vri) and over the phone interpretation (opi). it’s possible to even connect with an interpreter in a named language within several minutes of submitting a request. there is no excuse to provide a poor service to those who don’t have good spoken english.
As I travel around, I can�t believe what I�m hearing! Many in church simply tell others what they want to here. They don�t want to preach the truth� Because of fear! You�ll have a hard time finding their Bible come Monday! Indulging themselves in many lusts, they�re not ashamed. Where the Holy Spirit will clean up every room! Have your sins been washed away? Are they as white as snow? Won�t you allow God�s truth to �pierce� your heart within? Please don�t allow God�s truth to disappear from you today! Allow it to transform your life in a Godly kind of way! Jesus will never disappoint you and offers his atonement! His love can totally change your life this very moment!
as i travel around, i can�t believe what i�m hearing! many in church simply tell others what they want to here. they don�t want to preach the truth� because of fear! you�ll have a hard time finding their bible come monday! indulging themselves in many lusts, they�re not ashamed. where the holy spirit will clean up every room! have your sins been washed away? are they as white as snow? won�t you allow god�s truth to �pierce� your heart within? please don�t allow god�s truth to disappear from you today! allow it to transform your life in a godly kind of way! jesus will never disappoint you and offers his atonement! his love can totally change your life this very moment!
When I do panels about editorial matters at conventions, a significant percentage of the questions I field regard that holy-grail-of-a-breakout-story: getting picked out of Tor’s massive pile of unsolicited manuscripts and getting published. So I’m pleased to offer up this month’s free e-book—Spaceman Blues, the first novel by Brian Francis Slattery, who’s been hanging out around here lately and blogging about economics—as an example of the kind of book that may just jolt us out of our submission-reading stupor and get us to take notice. My preposterous (but hopefully effective) cover copy for Spaceman Blues called it a “literary retro-pulp science-fiction–mystery–superhero novel.” But when I think back to why I first picked up this book and started reading it, I can’t help recalling a line Brian wrote on his cover letter when he first submitted the book to us a bit over five years ago: “This book is painted in browns and grays, sparked by sudden fires. I suspect it is not for everyone, though I hope it is for you.” Here’s your opportunity to find out which camp you fall in. If you do turn out to be a fan of Brian’s, you may wish to check out his second novel, Liberation: Being the Adventures of the Slick Six After the Collapse of the United States of America, which is unrelated to Spaceman, but just as marvelous. As usual, the links above will only work if you’ve registered for Tor.com and are logged in, so if you haven’t joined the site, you might want to do so now. In return, you’ll get access to this book, many other useful site features, and more free e-books in the months to come. UPDATE 25 November: This book is now no longer available for free download.
when i do panels about editorial matters at conventions, a significant percentage of the questions i field regard that holy-grail-of-a-breakout-story: getting picked out of tor’s massive pile of unsolicited manuscripts and getting published. so i’m pleased to offer up this month’s free e-book—spaceman blues, the first novel by brian francis slattery, who’s been hanging out around here lately and blogging about economics—as an example of the kind of book that may just jolt us out of our submission-reading stupor and get us to take notice. my preposterous (but hopefully effective) cover copy for spaceman blues called it a “literary retro-pulp science-fiction–mystery–superhero novel.” but when i think back to why i first picked up this book and started reading it, i can’t help recalling a line brian wrote on his cover letter when he first submitted the book to us a bit over five years ago: “this book is painted in browns and grays, sparked by sudden fires. i suspect it is not for everyone, though i hope it is for you.” here’s your opportunity to find out which camp you fall in. if you do turn out to be a fan of brian’s, you may wish to check out his second novel, liberation: being the adventures of the slick six after the collapse of the united states of america, which is unrelated to spaceman, but just as marvelous. as usual, the links above will only work if you’ve registered for tor.com and are logged in, so if you haven’t joined the site, you might want to do so now. in return, you’ll get access to this book, many other useful site features, and more free e-books in the months to come. update 25 november: this book is now no longer available for free download.
Streaming services are busting out analytics in order to increase their competitiveness in a fast-growing market. Slacker radio, a U.S.-based music streaming service, announced on Thursday their latest foray into providing what they brand as the most complete music service out there – their “engagement quotient” score. Based on data gathered from the actions their users are taking when listening to music through the service, Slacker will be publishing weekly charts of top songs, across several genres including pop, electronic and country. Jack Isquith, senior vice president of content programming and strategic development, said that for the past year they have been focused on harnessing the data they have been informally using to help determine station programming. “This data is far more sophisticated and rich than the data of the traditional music industry and chart methodology,” said Isquith, explaining that terrestrial radio uses methods such as call out research to gauge what people may or may not want to hear. Isquith describes this as “dirty data,” and says there is a clear need for a more accurate method of tracking audience engagement. Slacker currently boasts a catalogue of more than 13 million songs, according to Isquith has about 30 million registered users, and somewhere between 5 to 6 million monthly active users. A recent article from Digital Music News cites their number of paying subscribers as around 560,000 in total. Slacker has 250 pre-programmed stations that are hosted and incorporate news, sports and weather programming, and users are able to create custom stations and stream tracks on-demand, depending on their level of subscription. So what actions are Slacker tracking? The “secret sauce” of how they weigh the data is obviously a secret, but there are seven basic actions that Slacker’s user can perform. The metrics include the amount of times a track is started, when a song is listened to in full, the number of times a track is “hearted” or shared through social media, as well as negative actions such as skips, channel changes or an altogether ban. As the music streaming service space becomes more and more established in North America, the varying services will continue to explore options for providing additional features in order to attract subscribers. Spotify for instance, in addition to recent investments in music discovery, publish charts of their most played tracks and recently introduced global play counts. We are likely to see more of these developments as the competition for new users of streaming services intensifies.
streaming services are busting out analytics in order to increase their competitiveness in a fast-growing market. slacker radio, a u.s.-based music streaming service, announced on thursday their latest foray into providing what they brand as the most complete music service out there – their “engagement quotient” score. based on data gathered from the actions their users are taking when listening to music through the service, slacker will be publishing weekly charts of top songs, across several genres including pop, electronic and country. jack isquith, senior vice president of content programming and strategic development, said that for the past year they have been focused on harnessing the data they have been informally using to help determine station programming. “this data is far more sophisticated and rich than the data of the traditional music industry and chart methodology,” said isquith, explaining that terrestrial radio uses methods such as call out research to gauge what people may or may not want to hear. isquith describes this as “dirty data,” and says there is a clear need for a more accurate method of tracking audience engagement. slacker currently boasts a catalogue of more than 13 million songs, according to isquith has about 30 million registered users, and somewhere between 5 to 6 million monthly active users. a recent article from digital music news cites their number of paying subscribers as around 560,000 in total. slacker has 250 pre-programmed stations that are hosted and incorporate news, sports and weather programming, and users are able to create custom stations and stream tracks on-demand, depending on their level of subscription. so what actions are slacker tracking? the “secret sauce” of how they weigh the data is obviously a secret, but there are seven basic actions that slacker’s user can perform. the metrics include the amount of times a track is started, when a song is listened to in full, the number of times a track is “hearted” or shared through social media, as well as negative actions such as skips, channel changes or an altogether ban. as the music streaming service space becomes more and more established in north america, the varying services will continue to explore options for providing additional features in order to attract subscribers. spotify for instance, in addition to recent investments in music discovery, publish charts of their most played tracks and recently introduced global play counts. we are likely to see more of these developments as the competition for new users of streaming services intensifies.
Fox has handed a 13-episode series order to animated family comedy Duncanville, from Amy Poehler and her Paper Kite Productions, The Simpsons‘ veteran Mike Scully and his wife, former Simpsons writer-producer Julie Scully, 20th Century Fox TV and Universal TV, where Poehler is under a development deal. Fox had ordered a script and pilot presentation for the previously untitled project last year. Written by Mike and Julie Scully, Duncanville features Poehler as the voice of two characters, along with Emmy nominee Rashida Jones (Parks and Recreation, Angie Tribeca) and Golden Globe nominee Wiz Khalifa (American Dad!, BoJack Horseman). It’s slated to premiere during the 2019-2020 season. The series centers on the life of Duncan, a spectacularly average 15-year-old boy, his family and friends. Poehler will provide the voice of Duncan and his high-strung mom, Annie, who is constantly trying to prevent her son from ruining his life. Produced by 20th Century Fox Television and Universal Television, Duncanville was co-created by Mike and Julie Scully and Amy Poehler, through her Paper Kite Productions, who executive-produce with Dave Becky of 3 Arts Entertainment. Joy will voice the role of Duncan’s younger sister. Joy voices the AI character Failsafe for the Destiny 2 videogame from Bungie.
fox has handed a 13-episode series order to animated family comedy duncanville, from amy poehler and her paper kite productions, the simpsons‘ veteran mike scully and his wife, former simpsons writer-producer julie scully, 20th century fox tv and universal tv, where poehler is under a development deal. fox had ordered a script and pilot presentation for the previously untitled project last year. written by mike and julie scully, duncanville features poehler as the voice of two characters, along with emmy nominee rashida jones (parks and recreation, angie tribeca) and golden globe nominee wiz khalifa (american dad!, bojack horseman). it’s slated to premiere during the 2019-2020 season. the series centers on the life of duncan, a spectacularly average 15-year-old boy, his family and friends. poehler will provide the voice of duncan and his high-strung mom, annie, who is constantly trying to prevent her son from ruining his life. produced by 20th century fox television and universal television, duncanville was co-created by mike and julie scully and amy poehler, through her paper kite productions, who executive-produce with dave becky of 3 arts entertainment. joy will voice the role of duncan’s younger sister. joy voices the ai character failsafe for the destiny 2 videogame from bungie.
Gswede Sunday: Take your Life Up (or down) a Notch in 2011! Take your Life Up (or down) a Notch in 2011! Since I don’t believe in New Year’s resolutions (most don’t stick to them), I embrace the beginning of each year with the intention of finding ways in which I can improve the benefits in my life. “Taking it UP (or down) a Notch” is my focus in 2011. Everyone has parts of their life that they adore or enjoy whether it be hobbies, family, work, playing with your kids, sports, “Me Time”, cooking, getting a massage, networking or simply relaxing. Whatever your particular passion may be, I encourage you to embrace it even more in 2011. Or if you have not started that book you want to write or begun the exercise you desire, there is no time like the present to move forward! Take it up a notch. Life should be about getting as much FUN out of it as you can so why not increase the level of pleasure with those things you most enjoy. I enjoy running and have made it a priority to improve my jogging consistency in 2011. In addition, I want to take my “helping of others” to a new level. This year, I’ve added a new twist to my goals - including lessening or getting rid of elements that don’t add value to my life or I don’t enjoy. Thankfully, there aren’t many although there are a few that will be firmly decreased as they are counter-productive and often waste my time. I understand that certain elements of our life must be dealt with whether we enjoy them or not. In my opinion, most things we don’t like or are not pleasant for us are BY CHOICE. Can you or people you know relate to any of these? If you can relate to any of the aforementioned, I implore you to do something about it while you still have the chance. Don’t be afraid to tackle the problem head on because if you have a person, action or job that is bringing you down or adding negativity to your life, where is the benefit for you? Take it down a notch! M) You are # 1 – If you are not, how can you live a good life or benefit others? People tend to forget that taking care of YOU FIRST is the most important thing in life. Living life for others or through others is a sure way to experience a HO HUM existence. There are many ways to achieve this no matter how busy you are in life. One is to act on a passion you have and make sure to do it every week if only for an hour. Surely you can spare an hour? You will be surprised how that one hour enhances your life. I have been thinking about starting a blog for years but never acted on it. I finally began it last year during one of the busiest times in my life and the benefits have been amazing! Things that don’t add joy and/or value to your life are “time wasters” and I don’t think anyone reading this wants to waste the precious and often short time we have. Take Your Life up (or down) a Notch, depending on where your life is right now. The best thing is to always be searching for ways to do this whether it is January, June or November. Positive change is never easy although those bold enough to do it often experience joy and/or peace of mind that they never thought possible. Gswede looks forward to every year including 2011! So true, so healthy and enriching to hear again and again. Still trying to move in that direction. Thanks George! Men at Age 50 – How do you Feel?
gswede sunday: take your life up (or down) a notch in 2011! take your life up (or down) a notch in 2011! since i don’t believe in new year’s resolutions (most don’t stick to them), i embrace the beginning of each year with the intention of finding ways in which i can improve the benefits in my life. “taking it up (or down) a notch” is my focus in 2011. everyone has parts of their life that they adore or enjoy whether it be hobbies, family, work, playing with your kids, sports, “me time”, cooking, getting a massage, networking or simply relaxing. whatever your particular passion may be, i encourage you to embrace it even more in 2011. or if you have not started that book you want to write or begun the exercise you desire, there is no time like the present to move forward! take it up a notch. life should be about getting as much fun out of it as you can so why not increase the level of pleasure with those things you most enjoy. i enjoy running and have made it a priority to improve my jogging consistency in 2011. in addition, i want to take my “helping of others” to a new level. this year, i’ve added a new twist to my goals - including lessening or getting rid of elements that don’t add value to my life or i don’t enjoy. thankfully, there aren’t many although there are a few that will be firmly decreased as they are counter-productive and often waste my time. i understand that certain elements of our life must be dealt with whether we enjoy them or not. in my opinion, most things we don’t like or are not pleasant for us are by choice. can you or people you know relate to any of these? if you can relate to any of the aforementioned, i implore you to do something about it while you still have the chance. don’t be afraid to tackle the problem head on because if you have a person, action or job that is bringing you down or adding negativity to your life, where is the benefit for you? take it down a notch! m) you are # 1 – if you are not, how can you live a good life or benefit others? people tend to forget that taking care of you first is the most important thing in life. living life for others or through others is a sure way to experience a ho hum existence. there are many ways to achieve this no matter how busy you are in life. one is to act on a passion you have and make sure to do it every week if only for an hour. surely you can spare an hour? you will be surprised how that one hour enhances your life. i have been thinking about starting a blog for years but never acted on it. i finally began it last year during one of the busiest times in my life and the benefits have been amazing! things that don’t add joy and/or value to your life are “time wasters” and i don’t think anyone reading this wants to waste the precious and often short time we have. take your life up (or down) a notch, depending on where your life is right now. the best thing is to always be searching for ways to do this whether it is january, june or november. positive change is never easy although those bold enough to do it often experience joy and/or peace of mind that they never thought possible. gswede looks forward to every year including 2011! so true, so healthy and enriching to hear again and again. still trying to move in that direction. thanks george! men at age 50 – how do you feel?
Browse answered Pelco Spectra IV DD423 questions, problems & issues. Get free expert troubleshooting help, support & repair solutions for all Camera. Page 5 Get free expert troubleshooting help, support & repair solutions for all Camera. Cm9760-cdu-t Manual 006 power runner motorized treadmill manual. Search. Recent Posts. Zend framework manual offline В· Freud 1700 router manual В· Pelco cm9760-cdu-t manual.
browse answered pelco spectra iv dd423 questions, problems & issues. get free expert troubleshooting help, support & repair solutions for all camera. page 5 get free expert troubleshooting help, support & repair solutions for all camera. cm9760-cdu-t manual 006 power runner motorized treadmill manual. search. recent posts. zend framework manual offline в· freud 1700 router manual в· pelco cm9760-cdu-t manual.
Bristol Ridge Estates: Thirty-eight (38) private home sites nestled in Grand Rapids’ northwest side in the city of Walker. Bristol Ridge provides a rural, convenient neighborhood experiencing the surrounding nature of rolling terrain and wooded areas. Conveniently located close to schools, restaurants, shopping and easy freeway access. The features, design, and attention to detail, provide the quality you have come to know and expect from a Steve Visser built home. This development will combine the years of home building and development experience in this quality neighborhood. Bristol Ridge has distinguished itself as one of the area’s finest communities.
bristol ridge estates: thirty-eight (38) private home sites nestled in grand rapids’ northwest side in the city of walker. bristol ridge provides a rural, convenient neighborhood experiencing the surrounding nature of rolling terrain and wooded areas. conveniently located close to schools, restaurants, shopping and easy freeway access. the features, design, and attention to detail, provide the quality you have come to know and expect from a steve visser built home. this development will combine the years of home building and development experience in this quality neighborhood. bristol ridge has distinguished itself as one of the area’s finest communities.
I want to take this opportunity to thank those who have served in our nations military. Many veterans have given the ultimate sacrifice, of their lives, to keep this nation free. Unfortunately the renegade in the White House has made executive actions undermining our nations freedoms. Patriots are being drummed out of the highest ranks of our military because they will not turn on American citizens. Patriots, constitutionalists, 2nd amendment rights activists and Christians, are now labeled as terrorists! Meanwhile, our government is actively pursuing muslims to populate our cities. The majority of these so called, refugees are military age young men. They will get free housing, healthcare, food stamps and $35,000 dollars a year per person! And our veterans are going without adequate healthcare, without adequate housing and are labeled as terrorists! What is wrong with this picture?! These policies make me physically ill. Over 2,000 vets a day are committing suicide. This is not your Grandpa’s country. If you would like more information on this and subjects like this visit http://www.hagmannandhagmann.com and listen to their radio show. Thank you vets for your service! So, I made this red, white and blue blanket to commemorate our nations military heroes. If you would like to purchase this twin sized blanket please contact me at [email protected]. I used regular red Heart Super Saver yarn and it took me about 3 months to make! Well, I was going to post a picture of the rest of the gang but even though I put all of my pictures on a SD card, this tablet is still telling me it has low memory! I may have to just write my blog from my roommate’s laptop. I bought this stupid thing so I didn’t have to use her computer! <sigh> stuff happens. Then it happens some more. Hopefully I will be able to share some pictures with you tomorrow. I would like you to meet Lily! She is one of the amigurumi animals I have made. She is also, one of the three, mascots for Cabin Crochet Creations! Sheldon, and TJ are the other two and (hopefully) I will be posting pictures of them next. In the polyform clay medium, I will be attempting to make a butterfly necklace out of the lace cane I made the other day. I purchased some more colors and some necessary tools because this looks like it is going to be somethings else I enjoy. I have always loved squishing clay in my fingers. I took some art classes a LONG time ago where we worked with clay. This clay is something completely different. My friend said “You are really going to buy all this for play-dough?”. It is nothing like play-dough. Iit has more characteristics of white clay than play-dough. What I love is that you don’t have to bake it in a kiln. You just stick it in an oven at approximately 275 degrees (look on the package because different brands require different temperatures). Well, it is off to the kitchen to play with my clay! Meanwhile, I have just started amigurumi. Which is a Japanese art form where you crochet animals, dolls and some people even make crocheted food! You use a very small crochet hook and usually a thiner yarn, like dk which means a double knit strand of yarn. I found that using regular aluminum crochet hooks, my hand starts to hurt! I found a great solution courtesy of Janey at the Dabbles and Babbles blog. She used polymer clay to make custom handles on her crochet hooks. Well, I used her excellent instructions and made some custom handles of my own! I really wish I could upload pictures to show you, but I am not able to right now. When I finished the crochet hook handles, I was thinking “what do I do with the rest of the polymer clay I bought?”. I did a few searches and found some great videos and picture tutorials of what people are creating out of polymer clay! I have discovered canes. Canes are a two dimensional picture in a three dimensional cylinder. Then you take slices of that cylinder to make beads and many other things. Thanks to Kelly Donavon at knittingandthings.com I made a beautiful lace cane that I am going to use to create a butterfly pendant! Uh-oh…I think I may have a new addiction on my hands! At least I can split my time between crochet and polymer clay. Blessings! Why I chose to blog. HI! I am a mom with grown children. I was a Registered Nurse for 14 years. I wanted to do something that wasn’t always life or death. I discovered crochet and it turns out I have a talent for it. I started this blog to give others inspiration. If you a retired or can’t work anymore you might have a natural ability to do something artistic with your hands. It might not be knitting or crochet, but you might have a knack for polymer clay art or needlepoint. After so many years rushing about, I feel that we have to do something to give out life meaning. Mine just happens to be crochet. I wanted to share with people what I have made. Truthfully, I want you to buy my handmade crochet items. I am going to be opening an Etsy shop and you will be able to purchase what I showcase here. I will also take custom orders from you! Yes! You can contact me and we can discuss size and materials you would like your personalized item to be made from. My email address is [email protected]! Everyone have a blessed day!
i want to take this opportunity to thank those who have served in our nations military. many veterans have given the ultimate sacrifice, of their lives, to keep this nation free. unfortunately the renegade in the white house has made executive actions undermining our nations freedoms. patriots are being drummed out of the highest ranks of our military because they will not turn on american citizens. patriots, constitutionalists, 2nd amendment rights activists and christians, are now labeled as terrorists! meanwhile, our government is actively pursuing muslims to populate our cities. the majority of these so called, refugees are military age young men. they will get free housing, healthcare, food stamps and $35,000 dollars a year per person! and our veterans are going without adequate healthcare, without adequate housing and are labeled as terrorists! what is wrong with this picture?! these policies make me physically ill. over 2,000 vets a day are committing suicide. this is not your grandpa’s country. if you would like more information on this and subjects like this visit http://www.hagmannandhagmann.com and listen to their radio show. thank you vets for your service! so, i made this red, white and blue blanket to commemorate our nations military heroes. if you would like to purchase this twin sized blanket please contact me at [email protected]. i used regular red heart super saver yarn and it took me about 3 months to make! well, i was going to post a picture of the rest of the gang but even though i put all of my pictures on a sd card, this tablet is still telling me it has low memory! i may have to just write my blog from my roommate’s laptop. i bought this stupid thing so i didn’t have to use her computer! <sigh> stuff happens. then it happens some more. hopefully i will be able to share some pictures with you tomorrow. i would like you to meet lily! she is one of the amigurumi animals i have made. she is also, one of the three, mascots for cabin crochet creations! sheldon, and tj are the other two and (hopefully) i will be posting pictures of them next. in the polyform clay medium, i will be attempting to make a butterfly necklace out of the lace cane i made the other day. i purchased some more colors and some necessary tools because this looks like it is going to be somethings else i enjoy. i have always loved squishing clay in my fingers. i took some art classes a long time ago where we worked with clay. this clay is something completely different. my friend said “you are really going to buy all this for play-dough?”. it is nothing like play-dough. iit has more characteristics of white clay than play-dough. what i love is that you don’t have to bake it in a kiln. you just stick it in an oven at approximately 275 degrees (look on the package because different brands require different temperatures). well, it is off to the kitchen to play with my clay! meanwhile, i have just started amigurumi. which is a japanese art form where you crochet animals, dolls and some people even make crocheted food! you use a very small crochet hook and usually a thiner yarn, like dk which means a double knit strand of yarn. i found that using regular aluminum crochet hooks, my hand starts to hurt! i found a great solution courtesy of janey at the dabbles and babbles blog. she used polymer clay to make custom handles on her crochet hooks. well, i used her excellent instructions and made some custom handles of my own! i really wish i could upload pictures to show you, but i am not able to right now. when i finished the crochet hook handles, i was thinking “what do i do with the rest of the polymer clay i bought?”. i did a few searches and found some great videos and picture tutorials of what people are creating out of polymer clay! i have discovered canes. canes are a two dimensional picture in a three dimensional cylinder. then you take slices of that cylinder to make beads and many other things. thanks to kelly donavon at knittingandthings.com i made a beautiful lace cane that i am going to use to create a butterfly pendant! uh-oh…i think i may have a new addiction on my hands! at least i can split my time between crochet and polymer clay. blessings! why i chose to blog. hi! i am a mom with grown children. i was a registered nurse for 14 years. i wanted to do something that wasn’t always life or death. i discovered crochet and it turns out i have a talent for it. i started this blog to give others inspiration. if you a retired or can’t work anymore you might have a natural ability to do something artistic with your hands. it might not be knitting or crochet, but you might have a knack for polymer clay art or needlepoint. after so many years rushing about, i feel that we have to do something to give out life meaning. mine just happens to be crochet. i wanted to share with people what i have made. truthfully, i want you to buy my handmade crochet items. i am going to be opening an etsy shop and you will be able to purchase what i showcase here. i will also take custom orders from you! yes! you can contact me and we can discuss size and materials you would like your personalized item to be made from. my email address is [email protected]! everyone have a blessed day!
We specialize in providing home care for seniors by referring the best caregivers for each and every situation. At Charmed Life Homecare, our philosophy on referring caregivers is simple. We only refer caregivers that we would want caring for our own family members. Because of that, we only select the best to care for you and your family. And if you are ever less than fully satisfied with a caregiver we have referred, let us know as soon as possible and we will be happy to find a replacement right away. Having an exceptional caregiver can make all the difference in your loved one’s quality of life. If your loved one needs assistance at home, we can help. Let Charmed Life Homecare help your loved one maintain their independence and remain in their home.
we specialize in providing home care for seniors by referring the best caregivers for each and every situation. at charmed life homecare, our philosophy on referring caregivers is simple. we only refer caregivers that we would want caring for our own family members. because of that, we only select the best to care for you and your family. and if you are ever less than fully satisfied with a caregiver we have referred, let us know as soon as possible and we will be happy to find a replacement right away. having an exceptional caregiver can make all the difference in your loved one’s quality of life. if your loved one needs assistance at home, we can help. let charmed life homecare help your loved one maintain their independence and remain in their home.
Why can't I be one of those mentals? I was worried about this piece because it is pretty damned obtuse and perhaps could be read as if/as though it's old school mental health shaming - you know, mocking the crazees. But then I thought, it's obtuse because I'm exploring my own mental health history and any mocking is of myself because I just don't understand that foreign country; my own past. I feel like I may have gone through a mental breakdown, only when I wasn't looking. And now I wonder how many people does that happen to???
why can't i be one of those mentals? i was worried about this piece because it is pretty damned obtuse and perhaps could be read as if/as though it's old school mental health shaming - you know, mocking the crazees. but then i thought, it's obtuse because i'm exploring my own mental health history and any mocking is of myself because i just don't understand that foreign country; my own past. i feel like i may have gone through a mental breakdown, only when i wasn't looking. and now i wonder how many people does that happen to???
Welcome to the Razorback District! Our District covers Washington and Madison Counties in Northwest Arkansas. Come see what Scouting has to offer your family.
welcome to the razorback district! our district covers washington and madison counties in northwest arkansas. come see what scouting has to offer your family.
Nitro Type News | XMaxx 2018 Event Starts December 1st! XMaxx 2018 Event Starts December 1st! What's the theme this year? So Fission and I were chatting with Jolly Saint Wampus the other day. As is the norm this time of year, he was deeply immersed in the danish tradition of Hygge, sippin' a double ristretto venti half-soy nonfat decaf organic iced gingerbread peppermint frappucino, extra hot with foam, whipped cream, double blended when suddenly he stopped, twitched his festive whiskers, and looked us directly in the eyes (which was impressive since he managed to look us both in the eyes at once) and uttered one word. Sweaters. Uhhh.. Sweaters? Fission and I looked at each other, shrugged, and went to work! We're not one to question he-who-gives-xp-bonuses after all. So uhh. Sweaters. Neat! So How About Some Holiday Music?
nitro type news | xmaxx 2018 event starts december 1st! xmaxx 2018 event starts december 1st! what's the theme this year? so fission and i were chatting with jolly saint wampus the other day. as is the norm this time of year, he was deeply immersed in the danish tradition of hygge, sippin' a double ristretto venti half-soy nonfat decaf organic iced gingerbread peppermint frappucino, extra hot with foam, whipped cream, double blended when suddenly he stopped, twitched his festive whiskers, and looked us directly in the eyes (which was impressive since he managed to look us both in the eyes at once) and uttered one word. sweaters. uhhh.. sweaters? fission and i looked at each other, shrugged, and went to work! we're not one to question he-who-gives-xp-bonuses after all. so uhh. sweaters. neat! so how about some holiday music?
The Urbanism Lab is devoted to the study of urbanism at the University of Chicago. It includes course materials, research projects, and resources relevant to the built environment. City Cents. Where does public money go? How much expenditure is devoted to strengthening civic life? How much of it is used to address the problem of human connectivity, for example by investing in neighborhood-scale civic spaces? This project is a spatial analysis of public expenditures at all levels (city, state, federal) in an effort to understand how public money contributes — or doesn’t — to a sense of neighborhood. The Urban Void. Vacant land in Chicago: where is it? who owns it? why does it sit fallow? This research presents a typology of vacantness and probes the civic, social, and economic implications of vacant land in Chicago’s neighborhoods. If cities are their streets, and streets are their uses, what do the profound changes in urban retail mean for the future of our cities? This project focuses on the current status and future prospects of small-scaled, walkable, and neighborhood-serving retail. Neighborhood-based retail used to play an active role in the life of urban neighborhoods. In the era of big box formula retail and e-commerce, is neighborhood-based retail still viable?
the urbanism lab is devoted to the study of urbanism at the university of chicago. it includes course materials, research projects, and resources relevant to the built environment. city cents. where does public money go? how much expenditure is devoted to strengthening civic life? how much of it is used to address the problem of human connectivity, for example by investing in neighborhood-scale civic spaces? this project is a spatial analysis of public expenditures at all levels (city, state, federal) in an effort to understand how public money contributes — or doesn’t — to a sense of neighborhood. the urban void. vacant land in chicago: where is it? who owns it? why does it sit fallow? this research presents a typology of vacantness and probes the civic, social, and economic implications of vacant land in chicago’s neighborhoods. if cities are their streets, and streets are their uses, what do the profound changes in urban retail mean for the future of our cities? this project focuses on the current status and future prospects of small-scaled, walkable, and neighborhood-serving retail. neighborhood-based retail used to play an active role in the life of urban neighborhoods. in the era of big box formula retail and e-commerce, is neighborhood-based retail still viable?
I would like to thank you for your interest in becoming a member of the 2018 Loudoun Valley High School golf team. I am looking forward to meeting each of you. I just wanted to give you all a little information about tryouts and the first week of the season and a little information about myself. I am a 2011 graduate from Loudoun Valley High School where I was a member of the golf team all four years. It was truly a great experience and I hope to be able to provide everyone on the team the same experience as I had. After I graduated from Loudoun Valley, I went on to play competitively in college at Christopher Newport University. I then went on to receive my Master’s in Kineseology from the University of Virginia. We will also have two assistant coaches who will be working with us this year; Dan Kaseman and Brad Sorgious. July 31st: Players will again meet on the putting green at Loudoun Golf and Country Club. The first hour will be spent working on different skills at the putting green, driving range, and chipping green. This will be followed by 9 holes and scores will be recorded. Cuts will be made on this day. IT IS VERY IMPORTANT THAT ALL THE NECESSARY PAPERWORK IS COMPLETE IN ORDER TO TRYOUT (See necessary forms below). IT WOULD BE BENEFICIAL TO HAVE FORMS FILLED OUT BY FRIDAY JULY 28. Insurance Form… All athletes must have some sort of insurance in order to compete. Each player will have an equal chance to be 1 of 12 spots on the team. Some things we will be looking for are total score, course ettiquete/understanding of the rules, and composure on the golf course. Our first tournament of the year takes place on August 1st so things will pick up very quickly. The players for this tournament will also be selected following the conclusion of the 9 holes on July 31st. It is important that we follow the dress code at Loudoun Golf and Country Club. This includes collared shirts (tucked in), and khaki shorts or pants (no basketball shorts or jeans). Metal spikes are not allowed at Loudoun Golf and Country Club. If you have interest in attending tryouts, please send me an email (email at top of this letter). Again, I am looking forward to meeting you all and am looking forward to a great year. If you have any questions, please do not hesitate to contact me.
i would like to thank you for your interest in becoming a member of the 2018 loudoun valley high school golf team. i am looking forward to meeting each of you. i just wanted to give you all a little information about tryouts and the first week of the season and a little information about myself. i am a 2011 graduate from loudoun valley high school where i was a member of the golf team all four years. it was truly a great experience and i hope to be able to provide everyone on the team the same experience as i had. after i graduated from loudoun valley, i went on to play competitively in college at christopher newport university. i then went on to receive my master’s in kineseology from the university of virginia. we will also have two assistant coaches who will be working with us this year; dan kaseman and brad sorgious. july 31st: players will again meet on the putting green at loudoun golf and country club. the first hour will be spent working on different skills at the putting green, driving range, and chipping green. this will be followed by 9 holes and scores will be recorded. cuts will be made on this day. it is very important that all the necessary paperwork is complete in order to tryout (see necessary forms below). it would be beneficial to have forms filled out by friday july 28. insurance form… all athletes must have some sort of insurance in order to compete. each player will have an equal chance to be 1 of 12 spots on the team. some things we will be looking for are total score, course ettiquete/understanding of the rules, and composure on the golf course. our first tournament of the year takes place on august 1st so things will pick up very quickly. the players for this tournament will also be selected following the conclusion of the 9 holes on july 31st. it is important that we follow the dress code at loudoun golf and country club. this includes collared shirts (tucked in), and khaki shorts or pants (no basketball shorts or jeans). metal spikes are not allowed at loudoun golf and country club. if you have interest in attending tryouts, please send me an email (email at top of this letter). again, i am looking forward to meeting you all and am looking forward to a great year. if you have any questions, please do not hesitate to contact me.
JUST REDUCED! Moments away from the ocean this 4 bedroom 2.5 bathroom home is what you are looking for. With a third of an acre, a beautiful screened in pool and lanai ready for entertaining this house is a sure win! But wait, there is more! Complete impact windows throughout and home generator perfect to keep you safe during storms. Beautifully updated bathrooms and a tasteful kitchen will make this the home of your dreams. Dynamite Boca Schools and a completely fenced in yard are perfect for everyone. Extra private yard that overlooks the new Boca Raton National Golf Club has the privacy and the view you are looking for! Don't wait to own the BEST Boca has to offer!
just reduced! moments away from the ocean this 4 bedroom 2.5 bathroom home is what you are looking for. with a third of an acre, a beautiful screened in pool and lanai ready for entertaining this house is a sure win! but wait, there is more! complete impact windows throughout and home generator perfect to keep you safe during storms. beautifully updated bathrooms and a tasteful kitchen will make this the home of your dreams. dynamite boca schools and a completely fenced in yard are perfect for everyone. extra private yard that overlooks the new boca raton national golf club has the privacy and the view you are looking for! don't wait to own the best boca has to offer!
History & Pearls: Memphis Nosh: Bacon Lover's Dishcrawl! It's Dishcrawl time again y'all! That is literally how excited I was about this Dishcrawl. "Bacon Lover's"? Bacon at every stop? I'm in. As you can probably tell by my "About Me" section, I really love bacon. I really really love bacon. So a Dishcrawl with bacon at every place, with bacon as the theme, surrounded by people who also love bacon, and hosted by the lovely Hollye of 381OhYum! For those of you unfamiliar with Dishcrawl, it's a meet up of food lovers, adventurous eaters, and people who want to get to know their city better through eating and mingling, and it's awesome. Each crawl has a theme, you buy a ticket, 48 hours before you get an email about the first meeting place, and then each place after (3-4 places total) is a surprise. It's in a ton of cities across the US, and is fun to do at home or in other cities as a tourist! On Monday, I got an email with exciting news - we were meeting a Bluefin, a Memphis favorite that I had sadly never been to before! We ate in the upstairs, kind of communal dining area, and it was fantastic - love the atmosphere! Our Dishcrawl guide, Hollye, gave us envelopes with strict instructions on how to open them. There were a TON of new people at this crawl, so the "What is Dishcrawl?" info was super helpful. And then we got to read what were eating. If you think I picked that bowl up and drank the broth after I was done with the ramen you are 100% correct. I am not ashamed. I love Belle, so I knew we were in for a treat. Okay. Let's have some real talk. I love any form of jalapeño popper. Clockwise from the top: A little puff pastry with a bacon rosette (dipped in chocolate) that they added for us, the popper of the gods, shrimp with mango bacon salsa, and pork loin with collard greens. The popper was literally one of the best things I've ever eaten. This little bacon pastry was amazing. I DO NOT like greens, but these were so good I could eat them every day. I've been on a mango salsa kick since this. You can see why. I clearly liked everything. Oh, and they gave us bread! So at this point I'm so stuffed. Instead of just eating one or two bites like a sane person, I ate all the food. I was struggling. So full. Possibly on the edge of a bacon coma. But I knew we had one more stop. And as we headed back towards Main, I realized that we must be going to one of my favorite places, Local Gastropub. Anyone who knows me knows that I spend a lot of time at the Local in Overton Square. One of my really good friends is a bartender there (although he happened to be downtown this night - hi Matt!) and I know a lot of the staff and it's close to my house and I love it. I rarely get downtown but I was starting to get really excited. So I haven't eaten a scallop in about 7 years. I had a bad experience. I ate scallops at a restaurant in Arkansas, which, yeah, was a bad plan. But this one was wrapped in bacon from a restaurant that I trust, so I resolved to do it. Plus, combine a bacon wrapped scallop, a giant slab of pork belly (no Brussel sprouts, but that was okay) and a piece of the bacon blondie with a huge piece of candied bacon on top, and you have a very very happy Amber. I may eat scallops again. I use a lot of exaggeration sometimes. But when I say that this is the best single bite of food I've ever eaten in my entire life, I mean it. If you see pork belly on anything at Local GET IT. The blondie was fantastic, but we all agreed it was so rich that that small piece was just enough. Definitely get the blondie to share! Besides the food, I made a ton of new friends (I knew a few people there, but went alone - everyone had to work or had stuff going on that night) and had a really great experience. One of my favorite things about Dishcrawl is that you get to sit communally, so you can talk to people you would normally not meet - I met a woman who takes international biking tours and was on her first Dishcrawl, a really nice couple who talked about college with me (their son is a senior in high school), and finally got to sit with some other local bloggers and friends. Everyone is super friendly, the food is amazing, and you get to experience new things. The next one is October 1st in the Broad Avenue Arts District - GO!
history & pearls: memphis nosh: bacon lover's dishcrawl! it's dishcrawl time again y'all! that is literally how excited i was about this dishcrawl. "bacon lover's"? bacon at every stop? i'm in. as you can probably tell by my "about me" section, i really love bacon. i really really love bacon. so a dishcrawl with bacon at every place, with bacon as the theme, surrounded by people who also love bacon, and hosted by the lovely hollye of 381ohyum! for those of you unfamiliar with dishcrawl, it's a meet up of food lovers, adventurous eaters, and people who want to get to know their city better through eating and mingling, and it's awesome. each crawl has a theme, you buy a ticket, 48 hours before you get an email about the first meeting place, and then each place after (3-4 places total) is a surprise. it's in a ton of cities across the us, and is fun to do at home or in other cities as a tourist! on monday, i got an email with exciting news - we were meeting a bluefin, a memphis favorite that i had sadly never been to before! we ate in the upstairs, kind of communal dining area, and it was fantastic - love the atmosphere! our dishcrawl guide, hollye, gave us envelopes with strict instructions on how to open them. there were a ton of new people at this crawl, so the "what is dishcrawl?" info was super helpful. and then we got to read what were eating. if you think i picked that bowl up and drank the broth after i was done with the ramen you are 100% correct. i am not ashamed. i love belle, so i knew we were in for a treat. okay. let's have some real talk. i love any form of jalapeño popper. clockwise from the top: a little puff pastry with a bacon rosette (dipped in chocolate) that they added for us, the popper of the gods, shrimp with mango bacon salsa, and pork loin with collard greens. the popper was literally one of the best things i've ever eaten. this little bacon pastry was amazing. i do not like greens, but these were so good i could eat them every day. i've been on a mango salsa kick since this. you can see why. i clearly liked everything. oh, and they gave us bread! so at this point i'm so stuffed. instead of just eating one or two bites like a sane person, i ate all the food. i was struggling. so full. possibly on the edge of a bacon coma. but i knew we had one more stop. and as we headed back towards main, i realized that we must be going to one of my favorite places, local gastropub. anyone who knows me knows that i spend a lot of time at the local in overton square. one of my really good friends is a bartender there (although he happened to be downtown this night - hi matt!) and i know a lot of the staff and it's close to my house and i love it. i rarely get downtown but i was starting to get really excited. so i haven't eaten a scallop in about 7 years. i had a bad experience. i ate scallops at a restaurant in arkansas, which, yeah, was a bad plan. but this one was wrapped in bacon from a restaurant that i trust, so i resolved to do it. plus, combine a bacon wrapped scallop, a giant slab of pork belly (no brussel sprouts, but that was okay) and a piece of the bacon blondie with a huge piece of candied bacon on top, and you have a very very happy amber. i may eat scallops again. i use a lot of exaggeration sometimes. but when i say that this is the best single bite of food i've ever eaten in my entire life, i mean it. if you see pork belly on anything at local get it. the blondie was fantastic, but we all agreed it was so rich that that small piece was just enough. definitely get the blondie to share! besides the food, i made a ton of new friends (i knew a few people there, but went alone - everyone had to work or had stuff going on that night) and had a really great experience. one of my favorite things about dishcrawl is that you get to sit communally, so you can talk to people you would normally not meet - i met a woman who takes international biking tours and was on her first dishcrawl, a really nice couple who talked about college with me (their son is a senior in high school), and finally got to sit with some other local bloggers and friends. everyone is super friendly, the food is amazing, and you get to experience new things. the next one is october 1st in the broad avenue arts district - go!
We are holding a VIP evening for all our ice cream lovers on Thursday 22nd November 7pm-10pm. We will be launching our new festive flavours and creations along with a glass or two of something bubbly or still, so come and join us at Ruby Violet HQ. For orders made on the night there will be 10% off, how can you resist? The Tufnell Stumble will be happening on the same evening, so please come along and celebrate with the other independent businesses of Tufnell Park. At Kings Cross we will be launching our festive flavours on Friday 23rd November 5-8pm with a glass of bubbly and 10% off orders made on the night. We’re so pleased to see that we’ve made it into Eurostar’s roundup of the best things to do in London… watch the video below to see their picks!
we are holding a vip evening for all our ice cream lovers on thursday 22nd november 7pm-10pm. we will be launching our new festive flavours and creations along with a glass or two of something bubbly or still, so come and join us at ruby violet hq. for orders made on the night there will be 10% off, how can you resist? the tufnell stumble will be happening on the same evening, so please come along and celebrate with the other independent businesses of tufnell park. at kings cross we will be launching our festive flavours on friday 23rd november 5-8pm with a glass of bubbly and 10% off orders made on the night. we’re so pleased to see that we’ve made it into eurostar’s roundup of the best things to do in london… watch the video below to see their picks!
The origin of the Teresian Carmelites or "discalced" and the meaning of our vocation in the Church are closely linked to the process of spiritual life and the charism of Teresa of Avila and John of the Cross. Driven by the love of Christ, our Holy Mother Teresa is part of the great living tradition, which after centuries attracts towards Mount Carmel, to find God in solitude and silence. Wounded by the breaks in the unity of the Church of her time and discovering new missionary horizons, she renews Carmel giving it a strong apostolic motivation. The first Carmel was founded by Teresa was San José de Avila, in Spain, on the feast day of the Apostle St. Bartholomew, August 24, 1562. In the blue sky that summer morning, resounded the toll of a bell announcing that there our Lord had settled together with his daughters. Thus began a new lifestyle in the Church. Over these four centuries they have blossomed as budding almond trees in the spring, hundreds of little dovecots where the Lord is served.
the origin of the teresian carmelites or "discalced" and the meaning of our vocation in the church are closely linked to the process of spiritual life and the charism of teresa of avila and john of the cross. driven by the love of christ, our holy mother teresa is part of the great living tradition, which after centuries attracts towards mount carmel, to find god in solitude and silence. wounded by the breaks in the unity of the church of her time and discovering new missionary horizons, she renews carmel giving it a strong apostolic motivation. the first carmel was founded by teresa was san josé de avila, in spain, on the feast day of the apostle st. bartholomew, august 24, 1562. in the blue sky that summer morning, resounded the toll of a bell announcing that there our lord had settled together with his daughters. thus began a new lifestyle in the church. over these four centuries they have blossomed as budding almond trees in the spring, hundreds of little dovecots where the lord is served.
Superfoods like lemon and garlic can prevent cancer. 3. Ruby Hall Clinic, Pune, Maharashtra, India. Kolhapur Cancer Center, Gokul-Shirgaon MIDC, Kolhapur-Kagal Road, Kolhapur. Maharashtra, India. Mahatma Gandhi Cancer Hospital, Near Gulabrao Patil Medical College, Miraj, Maharashtra, India. Copyright © 2019 Dr Chetan Deshmukh. All Rights Reserved. Website Development by MagicWorks IT Solutions Pvt. Ltd. Joomla! is Free Software released under the GNU General Public License.
superfoods like lemon and garlic can prevent cancer. 3. ruby hall clinic, pune, maharashtra, india. kolhapur cancer center, gokul-shirgaon midc, kolhapur-kagal road, kolhapur. maharashtra, india. mahatma gandhi cancer hospital, near gulabrao patil medical college, miraj, maharashtra, india. copyright © 2019 dr chetan deshmukh. all rights reserved. website development by magicworks it solutions pvt. ltd. joomla! is free software released under the gnu general public license.
It was a lifelong dream that was to life in 1990 when CEO Mrs. Muswar Afzal, stepped off a plane from Toronto to Lahore to begin her journey in the beauty industry of Pakistan. With her international diplomas, hours spent working in professional Canadian salons and her daughter by her side, she took a spontaneous plunge into her business career. Having instilled enthusiasm for hard work in her children, she confident Newlook will grow as a name synonymous with quality and customer care. Keen on enhancing their business heritage, Mrs. Afzal says, “There is much to achieve and when we see the opportunity for effective progress, there is no doubt that with Gods blessings, we will take it.
it was a lifelong dream that was to life in 1990 when ceo mrs. muswar afzal, stepped off a plane from toronto to lahore to begin her journey in the beauty industry of pakistan. with her international diplomas, hours spent working in professional canadian salons and her daughter by her side, she took a spontaneous plunge into her business career. having instilled enthusiasm for hard work in her children, she confident newlook will grow as a name synonymous with quality and customer care. keen on enhancing their business heritage, mrs. afzal says, “there is much to achieve and when we see the opportunity for effective progress, there is no doubt that with gods blessings, we will take it.
ATTENTION: YOU WILL BE ABLE TO SIGN UP IN THE AUTUMN OF 2019! Today's business world knows no borders. It is dynamic and technically demanding. Both cooperation and competition among European and Asian countries is on the rise. In order to succeed in this globalised environment with its huge cultural, economic and political differences, businesses need to adopt an agile, reflective, critical and entrepreneurial attitude. This course is designed to teach you the knowledge and skills that you need in order to conduct business in China with confidence and also to benefit from Chinese business opportunities in Europe. You will be challenged to tackle issues arising from real international business cases involving China and The Netherlands. The minor forms invaluable preparation for future business professionals. This interactive e-book offers you insight into the minor 'Doing Business with China'. You must have satisfied the requirements for the first year of your degree programme. You are expected to be an open-minded, inquisitive team player who can adapt to other cultures and who has an affinity with marketing and/or international business. You will be invited to attend an intake interview before the start of the minor. You will be invited to find solutions to real business cases and provide your advice to the real client. You will also acquire a basic knowledge of the Chinese language (HSK level 1= CEF A1) and explore the rich Chinese culture. The arts form a key aspect of the minor, and will contribute to your personal and intercultural development. You will also learn about international relations and the politics of China. 20 contact hours per week (on average). You will work both individually and in small groups (max. 16), under the guidance of a coach. In the fourth term, you will travel to China for two weeks to undertake research related to the business case (see description of the third term), with the aim of acquiring first-hand knowledge so that you can advise your clients accordingly at the end of the fourth term. This research is combined with activities designed to enable you to experience at first hand how the Chinese live and think. A business case involving international branding, consumer behaviour, trade risks and inbound tourism. Plus courses in the Chinese language, culture and the arts, and China in the world. Continuation of your business case, Chinese language, and Cross-cultural management. Assessments include portfolios, oral presentations and written tests. Eight minor students and two teachers visited Beijing, Tianjin, and Shanghai for a rich study program filled up with field research, Chinese language course, cultural activities, company visits and city tours in these three metropolitans in China. The Forbidden City and the Great Wall are no longer just pictures on the internet but rather places the students lingered around with vivid historical stories to remember with. Shadow boxing is no longer strange moves they saw in action movies but meaningful and philosophical martial arts that they find fascinating to practise. Talking to native Chinese people in their own language is rewarding in the field research. Chinese economy is no longer dull figures in books but rather personal experiences of entrepreneurs from the foreign businesses and companies that are doing business in China.
attention: you will be able to sign up in the autumn of 2019! today's business world knows no borders. it is dynamic and technically demanding. both cooperation and competition among european and asian countries is on the rise. in order to succeed in this globalised environment with its huge cultural, economic and political differences, businesses need to adopt an agile, reflective, critical and entrepreneurial attitude. this course is designed to teach you the knowledge and skills that you need in order to conduct business in china with confidence and also to benefit from chinese business opportunities in europe. you will be challenged to tackle issues arising from real international business cases involving china and the netherlands. the minor forms invaluable preparation for future business professionals. this interactive e-book offers you insight into the minor 'doing business with china'. you must have satisfied the requirements for the first year of your degree programme. you are expected to be an open-minded, inquisitive team player who can adapt to other cultures and who has an affinity with marketing and/or international business. you will be invited to attend an intake interview before the start of the minor. you will be invited to find solutions to real business cases and provide your advice to the real client. you will also acquire a basic knowledge of the chinese language (hsk level 1= cef a1) and explore the rich chinese culture. the arts form a key aspect of the minor, and will contribute to your personal and intercultural development. you will also learn about international relations and the politics of china. 20 contact hours per week (on average). you will work both individually and in small groups (max. 16), under the guidance of a coach. in the fourth term, you will travel to china for two weeks to undertake research related to the business case (see description of the third term), with the aim of acquiring first-hand knowledge so that you can advise your clients accordingly at the end of the fourth term. this research is combined with activities designed to enable you to experience at first hand how the chinese live and think. a business case involving international branding, consumer behaviour, trade risks and inbound tourism. plus courses in the chinese language, culture and the arts, and china in the world. continuation of your business case, chinese language, and cross-cultural management. assessments include portfolios, oral presentations and written tests. eight minor students and two teachers visited beijing, tianjin, and shanghai for a rich study program filled up with field research, chinese language course, cultural activities, company visits and city tours in these three metropolitans in china. the forbidden city and the great wall are no longer just pictures on the internet but rather places the students lingered around with vivid historical stories to remember with. shadow boxing is no longer strange moves they saw in action movies but meaningful and philosophical martial arts that they find fascinating to practise. talking to native chinese people in their own language is rewarding in the field research. chinese economy is no longer dull figures in books but rather personal experiences of entrepreneurs from the foreign businesses and companies that are doing business in china.
On the western side of Lake Ladoga, Dalyokaya Bukhta (60 deg 34.33N/30 deg 40.88E) is a peaceful, forested bay, guarded by two spectacular cardinal marks. Try finding these cardinals in bad weather! The water was glassy and the bay deserted but for two immobile fishermen and some sea otters frolicking on the rocks. Blue Dove is back in her element. Feels just like our time on the Volga. After morning douches in Ladoga’s fresh waters we shared coffee with a couple of curious locals who motored by. We are under constant surveillance by the authorities, who phoned us this morning to ask why we hadn’t told them of this stop en route Valaam. This drives our skipper crazy. It is only 15 miles to the 14th century monastic island of Konevets, where we can wait out some rain and fresh northerlies for a couple of days, stretch out legs and explore. Boat business is smooth. The new windlass is superb and our only unresolved issue is preparing the anchor. Its shackle is too big for the bow fairlead so you have to personhandle the anchor out through the pulpit. More than Maxine can manage. The solution is simple – an Italian slimline Kong connector, probably the most important item on her to do list. For now her elderly crew will do the grunt work. As he does.
on the western side of lake ladoga, dalyokaya bukhta (60 deg 34.33n/30 deg 40.88e) is a peaceful, forested bay, guarded by two spectacular cardinal marks. try finding these cardinals in bad weather! the water was glassy and the bay deserted but for two immobile fishermen and some sea otters frolicking on the rocks. blue dove is back in her element. feels just like our time on the volga. after morning douches in ladoga’s fresh waters we shared coffee with a couple of curious locals who motored by. we are under constant surveillance by the authorities, who phoned us this morning to ask why we hadn’t told them of this stop en route valaam. this drives our skipper crazy. it is only 15 miles to the 14th century monastic island of konevets, where we can wait out some rain and fresh northerlies for a couple of days, stretch out legs and explore. boat business is smooth. the new windlass is superb and our only unresolved issue is preparing the anchor. its shackle is too big for the bow fairlead so you have to personhandle the anchor out through the pulpit. more than maxine can manage. the solution is simple – an italian slimline kong connector, probably the most important item on her to do list. for now her elderly crew will do the grunt work. as he does.
Join Water of Life Ministries as they preach the gospel to you in word, song, and power! Doyle Davidson speaks this morning about not being able to see for the last eight years. He has thought 2017 would bring a major change, and he shares about being very encouraged recently at the last verse of Psalm 142. He says he expects to be in Plano when he is able to see again, compassed about with the righteous, ruling and reigning right here in Plano through the gift of righteousness. Kathie Davidson then ministers out of the Word of God about where Jesus went after He died. Jesus went to the “heart of the earth”, hell, and suffered the wrath of God, paying for our sins so we wouldn’t have to - if we believe on Him. Kathie's Message: "He Took God's Wrath For Us"
join water of life ministries as they preach the gospel to you in word, song, and power! doyle davidson speaks this morning about not being able to see for the last eight years. he has thought 2017 would bring a major change, and he shares about being very encouraged recently at the last verse of psalm 142. he says he expects to be in plano when he is able to see again, compassed about with the righteous, ruling and reigning right here in plano through the gift of righteousness. kathie davidson then ministers out of the word of god about where jesus went after he died. jesus went to the “heart of the earth”, hell, and suffered the wrath of god, paying for our sins so we wouldn’t have to - if we believe on him. kathie's message: "he took god's wrath for us"
Click to learn about the great news happening in the dynamic Ward 2 District of Norfolk, Va. Learn more about the important issues Courtney will focus on if elected as your councilwoman. Your support means everything to Courtney and her campaign for City Council.
click to learn about the great news happening in the dynamic ward 2 district of norfolk, va. learn more about the important issues courtney will focus on if elected as your councilwoman. your support means everything to courtney and her campaign for city council.
Last Friday, the PlayStation 4 launched in China after several delays from its original release date of January 11. While the console has been available in China through the grey market for some time, it’s the first time a Sony game console has ever legally been accepted there. As observed by media reports, the PS4 does not seem to be 100% region-locked the way the Xbox One is. China Xbox One consoles cannot play foreign Xbox One game disks (and vice-versa – foreign consoles cannot play China disks), download foreign games or connect to foreign servers. In contrast, China’s PS4s can play foreign game disks, connect to foreign servers, download game patches from servers abroad, and seems at least partly integrated to the global PlayStation Network – i.e. China owners can add as friends PSN members from abroad. Also overseas consoles can play China PS4 game disks, download patches from China servers and log into China PSN accounts. As such, while the authorities can choose at any time to clamp down if they believe developments are unsatisfactory, China’s PS4 buyers can secure in the grey market games already released in Hong Kong, and upcoming titles such as Bloodborne (release: 24 March 2015). All this has led to a significant rise in Sony’s stock value, their ADR rising 35.7% thanks to the success of the PS4 around the globe. Meanwhile Microsoft has been significantly outplayed by their gaming console rival in the stock market, falling 7.7 %. More and more investors are beginning to put faith into Sony to drive the gaming industry forward. Do you as consumers feel Sony is living up to that expectation? Let us know in the comments below.
last friday, the playstation 4 launched in china after several delays from its original release date of january 11. while the console has been available in china through the grey market for some time, it’s the first time a sony game console has ever legally been accepted there. as observed by media reports, the ps4 does not seem to be 100% region-locked the way the xbox one is. china xbox one consoles cannot play foreign xbox one game disks (and vice-versa – foreign consoles cannot play china disks), download foreign games or connect to foreign servers. in contrast, china’s ps4s can play foreign game disks, connect to foreign servers, download game patches from servers abroad, and seems at least partly integrated to the global playstation network – i.e. china owners can add as friends psn members from abroad. also overseas consoles can play china ps4 game disks, download patches from china servers and log into china psn accounts. as such, while the authorities can choose at any time to clamp down if they believe developments are unsatisfactory, china’s ps4 buyers can secure in the grey market games already released in hong kong, and upcoming titles such as bloodborne (release: 24 march 2015). all this has led to a significant rise in sony’s stock value, their adr rising 35.7% thanks to the success of the ps4 around the globe. meanwhile microsoft has been significantly outplayed by their gaming console rival in the stock market, falling 7.7 %. more and more investors are beginning to put faith into sony to drive the gaming industry forward. do you as consumers feel sony is living up to that expectation? let us know in the comments below.
The post Oui Monsieur Joyon, you are the fastest sailor in the world. Again! appeared first on Sail Universe.
the post oui monsieur joyon, you are the fastest sailor in the world. again! appeared first on sail universe.
You can often find us in the City of Westminster, but not usually on the ground. Trying to find suitable locations for shows in London with its dense population and high rise buildings is not easy. Our solution is simple, go up high above the streets where we work on some of London’s landmark properties, including the Savoy through to the Pearlfisher building in W6. Rooftops are always a challenge with significant access issues, fortunately our teams are extremely adept at navigating small spaces!
you can often find us in the city of westminster, but not usually on the ground. trying to find suitable locations for shows in london with its dense population and high rise buildings is not easy. our solution is simple, go up high above the streets where we work on some of london’s landmark properties, including the savoy through to the pearlfisher building in w6. rooftops are always a challenge with significant access issues, fortunately our teams are extremely adept at navigating small spaces!
OK – this is it. The waiting is finally over. The Cheltenham Festival is here and ready to entertain. It begins with a bang, and a roar that can be heard on the other side of the world – so the rumours go. Punters will be looking to get off to a flier in the opener but past records suggest the Supreme Novices Hurdle is very much a race where the bookmakers hold the upper hand. The records show that there has been no winning favourite in this race since 2004. Gambles on horses such as Cousin Vinny, Dunguib and Cue Card all have gone down the toilet, and this year’s contender, My Tent Or Yours, in our eyes, looks set to follow suit. One thing all the aforementioned market leaders have in common is that they’re strengths very much lie in speed over stamina. This is not a race anymore where the classier types dominate. Just look back through horses beaten in this race and you’ll see what we’re banging on about. Subsequent Champion Hurdle winner, Binocular and Arkle sensation Sprinter Sacre both were outstayed in the stamina sapping Supreme. My Tent Or Yours, who looks likely to go off around the even money mark with Paddy Power, looks by far the best horse, for future references, in the race but he may find one or two too good as he battles his way up the hill. Being able to rule out the favourite from any betting angle is always a potentially lucrative proposition and our negative vibes towards the Henderson runner opens up plenty of possibilities. Second favourite Jezki at 9/2 with Bet365, again, looks in the same mould as My Tent Or Your as being speedy rather than strong, so we’re ignoring him too. Une Atout looks a far stronger Irish challenger but is very inexperienced whilst Dodging Bullets has been popular in the ante-post markets, mostly because he’s trained by Paul Nicholls. However, his form probably isn’t good enough to land this contest. River Maigue has strong each-way claims at 12/1 for owner Michael Buckley, who had the runner-up here in 2011 with Spirit Son. He would have been our outright selection had the form of his Kempton win been hardened as he looks the perfect time to improve under the watch of Henderson. We’re delving very deep for our number one choice though as Cheltenian looks hugely overpriced around the 33/1 mark with Bet365 – each way punters should be filling their boots with this one. Trainer Phillip Hobbs, who trained a big price winner in the 2010 Supreme when Menorah ran out a gutsy victor, has been keeping very quiet about this horse – but that in-itself could a tip from the shrewd trainer. A previous Festival winner, having landed the 2011 Champion Bumper, the seven-year-old returned from a near two-year absence to run a fantastic race at Doncaster last month, beaten just a short head by Minella Forfitness. Under normal circumstances regarding his fitness, he would have hacked up that day as jockey Richard Johnson was always eager not to give the horse a too hard of a blow. Johnson was too gentle with him in the final stages, but by not giving him a hard race has probably meant he is now spot-on for his chance in the Supreme. There is a feeling that this year’s novice hurdlers, bar My Tent Or Yours, are a below standard bunch, and Cheltenian brings a different angle of form to the table through his Champion Bumper win, where last year’s Supreme Novices winner Cinders And Ashes was well beaten in fifth.
ok – this is it. the waiting is finally over. the cheltenham festival is here and ready to entertain. it begins with a bang, and a roar that can be heard on the other side of the world – so the rumours go. punters will be looking to get off to a flier in the opener but past records suggest the supreme novices hurdle is very much a race where the bookmakers hold the upper hand. the records show that there has been no winning favourite in this race since 2004. gambles on horses such as cousin vinny, dunguib and cue card all have gone down the toilet, and this year’s contender, my tent or yours, in our eyes, looks set to follow suit. one thing all the aforementioned market leaders have in common is that they’re strengths very much lie in speed over stamina. this is not a race anymore where the classier types dominate. just look back through horses beaten in this race and you’ll see what we’re banging on about. subsequent champion hurdle winner, binocular and arkle sensation sprinter sacre both were outstayed in the stamina sapping supreme. my tent or yours, who looks likely to go off around the even money mark with paddy power, looks by far the best horse, for future references, in the race but he may find one or two too good as he battles his way up the hill. being able to rule out the favourite from any betting angle is always a potentially lucrative proposition and our negative vibes towards the henderson runner opens up plenty of possibilities. second favourite jezki at 9/2 with bet365, again, looks in the same mould as my tent or your as being speedy rather than strong, so we’re ignoring him too. une atout looks a far stronger irish challenger but is very inexperienced whilst dodging bullets has been popular in the ante-post markets, mostly because he’s trained by paul nicholls. however, his form probably isn’t good enough to land this contest. river maigue has strong each-way claims at 12/1 for owner michael buckley, who had the runner-up here in 2011 with spirit son. he would have been our outright selection had the form of his kempton win been hardened as he looks the perfect time to improve under the watch of henderson. we’re delving very deep for our number one choice though as cheltenian looks hugely overpriced around the 33/1 mark with bet365 – each way punters should be filling their boots with this one. trainer phillip hobbs, who trained a big price winner in the 2010 supreme when menorah ran out a gutsy victor, has been keeping very quiet about this horse – but that in-itself could a tip from the shrewd trainer. a previous festival winner, having landed the 2011 champion bumper, the seven-year-old returned from a near two-year absence to run a fantastic race at doncaster last month, beaten just a short head by minella forfitness. under normal circumstances regarding his fitness, he would have hacked up that day as jockey richard johnson was always eager not to give the horse a too hard of a blow. johnson was too gentle with him in the final stages, but by not giving him a hard race has probably meant he is now spot-on for his chance in the supreme. there is a feeling that this year’s novice hurdlers, bar my tent or yours, are a below standard bunch, and cheltenian brings a different angle of form to the table through his champion bumper win, where last year’s supreme novices winner cinders and ashes was well beaten in fifth.
Lauren Oliver left us with an enormous cliffhanger at the end of Delirium, Pandemonium’s captivating predecessor. I hoped that this sequel would pull us back up again, and that it did, but in a way that I absolutely had not expected. She’s made her decision. But can she face the consequences? I don’t want to spoil anything here, but I will say that Pandemonium adds some new characters into the mix that lead Lena’s story in a whole new direction. I was surprised by this, but pleasantly. In fact, Pandemonium is one of those rare cases when the sequel is ten times better than the first in the series, and I had already given Delirium a five star rating. And it’s not just the new characters that make Pandemonium such a great read, it’s also the new structure that Lauren Oliver has introduced. Delirium was a pretty straight forward story with a narrative that took us from A to B, but Pandemonium shakes it up a bit with a ‘then’ and ‘now’ structure that takes the reader back and forth in time chapter by chapter. It’s a pretty mean feat to be able to pull this off without making things complicated and confusing, but Lauren Oliver has achieved it perfectly. Pandemonium is jam-packed full of action, and plenty of moments where you can actually feel your heart squeezing in your chest (to me, that’s a sign of a truly good book). Lauren Oliver has a way of really making you connect with the characters, which makes reading her work an experience, like you’re sprinting alongside them rather than watching them from afar. It’s an adventure. Plus, if you thought the cliffhanger at the end of Delirium was bad, wait until you get to the last page of Pandemonium. Seriously. ‘Holy sh*t’ is the phrase that springs to mind. Thank goodness I’ve already got my hands on a copy of the trilogy’s conclusion: Requiem. I’m not sure I could have stood the torture of having to wait a year to find out Lena’s fate. On that note, I had better get reading!
lauren oliver left us with an enormous cliffhanger at the end of delirium, pandemonium’s captivating predecessor. i hoped that this sequel would pull us back up again, and that it did, but in a way that i absolutely had not expected. she’s made her decision. but can she face the consequences? i don’t want to spoil anything here, but i will say that pandemonium adds some new characters into the mix that lead lena’s story in a whole new direction. i was surprised by this, but pleasantly. in fact, pandemonium is one of those rare cases when the sequel is ten times better than the first in the series, and i had already given delirium a five star rating. and it’s not just the new characters that make pandemonium such a great read, it’s also the new structure that lauren oliver has introduced. delirium was a pretty straight forward story with a narrative that took us from a to b, but pandemonium shakes it up a bit with a ‘then’ and ‘now’ structure that takes the reader back and forth in time chapter by chapter. it’s a pretty mean feat to be able to pull this off without making things complicated and confusing, but lauren oliver has achieved it perfectly. pandemonium is jam-packed full of action, and plenty of moments where you can actually feel your heart squeezing in your chest (to me, that’s a sign of a truly good book). lauren oliver has a way of really making you connect with the characters, which makes reading her work an experience, like you’re sprinting alongside them rather than watching them from afar. it’s an adventure. plus, if you thought the cliffhanger at the end of delirium was bad, wait until you get to the last page of pandemonium. seriously. ‘holy sh*t’ is the phrase that springs to mind. thank goodness i’ve already got my hands on a copy of the trilogy’s conclusion: requiem. i’m not sure i could have stood the torture of having to wait a year to find out lena’s fate. on that note, i had better get reading!
My husband and I have hosted Thanksgiving dinner for our families since the year we got engaged (10 years ag0). It was always a fun day for me, full of work and play. We snacked on olives and appetizers, set the table together, ate a big meal, cleared the table, and played board games into the evening. It was great. We did the same thing year after year. It was tradition. And then my mom died from pancreatic cancer. Our traditions all got tossed in the air. I can’t handle making Thanksgiving dinner without my mom coming over to make the gravy and bark orders about the bird and the potatoes. I think we have a new tradition now. We went out to eat last year with my husband’s family, and my kids thought that was a fine way to spend the holiday. It’s not my preference, but then, nothing seems to fit anymore. Despite my feelings about the actual day of Thanksgiving, I have much to be thankful for. My husband and I have created several thankful traditions that remind our family of the spirit of the holiday (especially leading into the greediness that often rears its ugly head during the Christmas season). Your family could easily do these on Thanksgiving day or the week before or after. 1. Read about the first Thanksgiving. I t wasn’t like you learned in elementary school. The pilgrims didn’t invite the Native Americans to join in a big feast to celebrate their hard work. Well, they sort of did, but there’s a lot more to the story. Check out Squanto and the Miracle of Thanksgiving for the whole story. Long before the first Thanksgiving, God was at work orchestrating a miracle. This book tells an amazing story about our BIG God. Don’t miss it. 2. Make a thankful poster. Take a piece of poster board or foam core, write THANKFUL or GRATEFUL in the middle in your fanciest handwriting, and hang a marker on it in a prominent space in your home. Encourage your family and your guests to get involved by writing what they’re thankful for and even by drawing little pictures or pasting pictures from magazines. When you’re finished, take a photo of the poster to keep for posterity, and compare the posters over the years to see what changes and what stays the same. 3. Make a thankful tree. Along the same lines as the above, get some pre-cut paper or felt leaves, write what you’re thankful for on them, and tape them to a paper or felt tree on a door, wall, or window. 4. Say 3 things you’re thankful for at dinner. It doesn’t have to be a Thanksgiving dinner (although you can do it then, too), but share your blessings with your family on a regular basis. Make a point of sharing your blessings in November, whether you’re donating food to a food bank or giving your time to an elderly neighbor. Help your children to see that being blessed means sharing what you have! Do you have any Thanksgiving family traditions? We’re always looking for new ways to celebrate all the ways God has blessed us, so we’d love to hear from you in the comments! This entry was posted in Blog and tagged Family, Gratitude, Squanto, Squanto and the Miracle of Thanksgiving, Thanksgiving, traditions by Tara Ziegmont. Bookmark the permalink.
my husband and i have hosted thanksgiving dinner for our families since the year we got engaged (10 years ag0). it was always a fun day for me, full of work and play. we snacked on olives and appetizers, set the table together, ate a big meal, cleared the table, and played board games into the evening. it was great. we did the same thing year after year. it was tradition. and then my mom died from pancreatic cancer. our traditions all got tossed in the air. i can’t handle making thanksgiving dinner without my mom coming over to make the gravy and bark orders about the bird and the potatoes. i think we have a new tradition now. we went out to eat last year with my husband’s family, and my kids thought that was a fine way to spend the holiday. it’s not my preference, but then, nothing seems to fit anymore. despite my feelings about the actual day of thanksgiving, i have much to be thankful for. my husband and i have created several thankful traditions that remind our family of the spirit of the holiday (especially leading into the greediness that often rears its ugly head during the christmas season). your family could easily do these on thanksgiving day or the week before or after. 1. read about the first thanksgiving. i t wasn’t like you learned in elementary school. the pilgrims didn’t invite the native americans to join in a big feast to celebrate their hard work. well, they sort of did, but there’s a lot more to the story. check out squanto and the miracle of thanksgiving for the whole story. long before the first thanksgiving, god was at work orchestrating a miracle. this book tells an amazing story about our big god. don’t miss it. 2. make a thankful poster. take a piece of poster board or foam core, write thankful or grateful in the middle in your fanciest handwriting, and hang a marker on it in a prominent space in your home. encourage your family and your guests to get involved by writing what they’re thankful for and even by drawing little pictures or pasting pictures from magazines. when you’re finished, take a photo of the poster to keep for posterity, and compare the posters over the years to see what changes and what stays the same. 3. make a thankful tree. along the same lines as the above, get some pre-cut paper or felt leaves, write what you’re thankful for on them, and tape them to a paper or felt tree on a door, wall, or window. 4. say 3 things you’re thankful for at dinner. it doesn’t have to be a thanksgiving dinner (although you can do it then, too), but share your blessings with your family on a regular basis. make a point of sharing your blessings in november, whether you’re donating food to a food bank or giving your time to an elderly neighbor. help your children to see that being blessed means sharing what you have! do you have any thanksgiving family traditions? we’re always looking for new ways to celebrate all the ways god has blessed us, so we’d love to hear from you in the comments! this entry was posted in blog and tagged family, gratitude, squanto, squanto and the miracle of thanksgiving, thanksgiving, traditions by tara ziegmont. bookmark the permalink.
Robert Madge is a young actor from Warwickshire. He attended the Sylvia Young Theatre School and is currently (2013) a pupil at Ashbourne College. One of his first roles was to perform in Matilda the Musical and has since then had roles in Les Misérables, Oliver and Mary Poppins. Previous audio readings include Maggot Moon by Sally Gardner. Margaret Mahy's many books - picture books, short stories, and fiction for teenagers as well as younger children - have been hugely successful all round the world and she is indisputably one of the most popular and successful twentieth-century children's authors. She has won the Carnegie Medal and many other awards, and has been nominated for the Hans Christian Andersen Award. She lived in New Zealand until her death in 2012. Julie Maisey is an accomplished actress who trained at The Webber Douglas Academy of Dramatic Art. Since graduating she has worked extensively in theatre and television including roles at The National Theatre , Hampstead Theatre and in Eastenders and the Bill. Voiceover highlights include the BAFTA nominated and British Animation Award winning 'Dad's Dead' and 'Peoples Britain' as well as the many audiobooks she has narrated over the years. She lives in London with her partner and young daughter. Anna trained at The London Academy of Music and Dramatic Art and she was nominated for an Olivier Award for her performance in `His Dark Materials`. She has also starred as Esther Summerson in the latest tv adaptation of BLEAK HOUSE, for which she won the 2006 Best Actress Bafta. Cliff McNish was born in Sunderland, but has spent most of his life in the southeast of England. His first book was THE DOOMSPELL, inspired by a story he told his daughter. Since then he has published THE SILVER SEQUENCE and the acclaimed stand-alone supernatural thrillers, BREATHE (winner of the Salford and Calderdale book awards), ANGEL, SAVANNAH GREY and THE HUNTING GROUND, as well as 2014's GOING HOME. Find out more at http://www.cliffmcnish.com, and follow him on Twitter at https://twitter.com/cliffmcnish and Facebook at https://www.facebook.com/cliff.mcnish. Emily Murdoch is a writer and poet. She is passionate about animal welfare and offers sanctuary to abused and abandoned horses on her family ranch in rural Arizona. IF YOU FIND ME is her first novel. Visit her website at http://www.emilymurdoch.com, read her blog at http://emilymurdoch.wordpress.com, follow her on Twitter at https://twitter.com/LeftyWritey and Facebook at https://www.facebook.com/emily.murdoch.author and like the page for If You Find Me at http://www.facebook.com/Ifyoufindme. Benjamin J. Myers was born in the Potteries in 1967. After studying Philosophy and Psychology at Leeds University, Myers attended the Royal Military Academy Sandhurst. He saw active service as a Troop Commander in the First Gulf War and is a qualified battlefield survival instructor. In 1993, he attained his Diploma in Law from the University of London and subsequently has been a barrister in a busy practice in Manchester, specialising in serious crime, often representing vulnerable defendants, in particular juveniles. He also lectures other legal professions on mentally disordered offenders and human rights. Married with three children, Benjamin Myers lives in North Cheshire. Visit the wiki-site for The Bad Tuesdays at http://the-bad-tuesdays.wikia.com/wiki and like it on Facebook at http://www.facebook.com/pages/The-Bad-Tuesdays/252612148088617.
robert madge is a young actor from warwickshire. he attended the sylvia young theatre school and is currently (2013) a pupil at ashbourne college. one of his first roles was to perform in matilda the musical and has since then had roles in les misérables, oliver and mary poppins. previous audio readings include maggot moon by sally gardner. margaret mahy's many books - picture books, short stories, and fiction for teenagers as well as younger children - have been hugely successful all round the world and she is indisputably one of the most popular and successful twentieth-century children's authors. she has won the carnegie medal and many other awards, and has been nominated for the hans christian andersen award. she lived in new zealand until her death in 2012. julie maisey is an accomplished actress who trained at the webber douglas academy of dramatic art. since graduating she has worked extensively in theatre and television including roles at the national theatre , hampstead theatre and in eastenders and the bill. voiceover highlights include the bafta nominated and british animation award winning 'dad's dead' and 'peoples britain' as well as the many audiobooks she has narrated over the years. she lives in london with her partner and young daughter. anna trained at the london academy of music and dramatic art and she was nominated for an olivier award for her performance in `his dark materials`. she has also starred as esther summerson in the latest tv adaptation of bleak house, for which she won the 2006 best actress bafta. cliff mcnish was born in sunderland, but has spent most of his life in the southeast of england. his first book was the doomspell, inspired by a story he told his daughter. since then he has published the silver sequence and the acclaimed stand-alone supernatural thrillers, breathe (winner of the salford and calderdale book awards), angel, savannah grey and the hunting ground, as well as 2014's going home. find out more at http://www.cliffmcnish.com, and follow him on twitter at https://twitter.com/cliffmcnish and facebook at https://www.facebook.com/cliff.mcnish. emily murdoch is a writer and poet. she is passionate about animal welfare and offers sanctuary to abused and abandoned horses on her family ranch in rural arizona. if you find me is her first novel. visit her website at http://www.emilymurdoch.com, read her blog at http://emilymurdoch.wordpress.com, follow her on twitter at https://twitter.com/leftywritey and facebook at https://www.facebook.com/emily.murdoch.author and like the page for if you find me at http://www.facebook.com/ifyoufindme. benjamin j. myers was born in the potteries in 1967. after studying philosophy and psychology at leeds university, myers attended the royal military academy sandhurst. he saw active service as a troop commander in the first gulf war and is a qualified battlefield survival instructor. in 1993, he attained his diploma in law from the university of london and subsequently has been a barrister in a busy practice in manchester, specialising in serious crime, often representing vulnerable defendants, in particular juveniles. he also lectures other legal professions on mentally disordered offenders and human rights. married with three children, benjamin myers lives in north cheshire. visit the wiki-site for the bad tuesdays at http://the-bad-tuesdays.wikia.com/wiki and like it on facebook at http://www.facebook.com/pages/the-bad-tuesdays/252612148088617.
One claim constantly made about artistically inclined people is that they lack realism. My response to that is that reality of human world is what people make of it; and such things are only unrealistic if people choose to make them so. If something is not in demand, then those who are willing to supply it either go starving or have to do something else. The problem is not with those who are willing to form the supply, but with those who undermine the demand. I see no reason at all why America, with 300 million people and per capita GDP of $50,000 a year, should have less good art than Renaissance Italy, with 3 million people and per capita GDP of $1,500 a year. The problem is not with realism or lack of realism. The problem is one of values. Clearly there have been times in history in which it was completely realistic to produce and distribute art. And the times and places where that was the case are the times and places to which we continue to look back now. So now we’ve come to a completely ridiculous point: Seeing artistic interest as psychopathology. You might as well say that it’s pathological to want to make money or to worship God. Treating such things as a psychopathology takes more resources than it would take to allow such people to be artists, and it does not produce any kind of benefit. There have been times in American history when that was not the attitude. In 1920s there was a magnificent artistic blossoming even at the same time as there was a great economic boom. Economic prosperity and artistic blossoming coexisted. They worked together with one another. And it was in this time – one that combined economic prosperity with artistic excellence – that America became the greatest country in the world. This means the following. Not only is it completely realistic to produce – and consume – art, but doing so is fully consistent with America’s values and America’s greatness. It is not for “snobs” or “liberal elites” or “pretentious Europeans.” It is something that has been done by patriotic Americans at the time that America rose to its greatest glory. It is fully realistic, as well as completely American, to produce and to consume art. The problem is lack of demand. The solution is increasing the demand while also producing supply of good art that people want to buy. Hi. I'd like to suggest that TV/movies are the dominant forms of art these days, and that just about everyone loves some kind of TV or movie. The demand is great. The product is sometimes great. And, for a few, the profit is great. For consumers the situation is arguably better than ever. For producers however the situation is arguably more difficult than ever. Perhaps I'm the best actor, director, or writer in my town or mid-sized city. I may still be uninteresting to a consumer who takes seeing the very best actors, directors, and writers in the world for granted. Of course it's possible that I'm ahead of my time, but this is probably the 'unrealistic' fantasy that many critics of the artistic personality have in mind. I'm far more likely to be behind my time than ahead of it, and I am less willing to explore that possibility than the consumer whose money I want. From such a perspective, it's more realistic (safer) to learn a technical skill that is clearly in demand in my pursuit of making a living and achieving status. I realize you may have had paintings and sculpture foremost in your mind, but I suggest that those are just not the forms of our electronic time. one of the real problems in the art world is that art is often used simply as a way to invest money; it is also sometimes used for money laundering. This can lead to artists, who make their art look esoteric,and bound up in some kind of mysterious high-minded philosophy which is hard to criticised, more popular...these paintings, sculptures etc, are worth millions, and there has to be a way to defend these high prices. And the defence opted for is in something which is portrayed as being beyond the understanding of mere ordinary people....this process also has the feedback effect of making rich people seem highly sophisticated, and above everybody else.....this approach to art is simply a bubble which needs popping. Can you explain how this solution might work? Or why it would be a good thing if it did work. Criticizing artworks for a lack of realism is a pet peeve of mine. I call it the "realism fetish." The solution is increasing the demand while also producing supply of good art that people want to buy. Well, for one, it would give a sense of purpose to the millions of the so-called mentally ill in this country who otherwise are undervalued or devalued by society. Western culture is highly materialistic/rationalistic. How do you increase aesthetic values in such a cultural environment? Good question. I don’t know, and I don’t know if it’s possible in this society where corporate profits are of paramount importance. "Western culture is highly materialistic/rationalistic. How do you increase aesthetic values in such a cultural environment?" Look back to 1920s and the Italian Renaissance. In both situations there was economic boom and cultural blossoming. "Can you explain how this solution might work? Or why it would be a good thing if it did work." It can work because it has worked in the past. It was called 1920s. It is desirable because we will see a vast legacy of beauty being created, and with it a golden age that people will cherish for ages to come. I’m not sure where the benefit lies in this for people today, unless you’re saying it will lead to an economic boom. I can’t find your connection between art and the economy, if that’s your point? But using the twenties as an example doesn’t help me either. The art movements that dominated the world were not from America but from Europe, and I had always though America’s greatness peaked after WWII. Edit: though the twenties were obviously a hedonistic age for Americans, so I take your point there. I think their art in terms of realism blossomed in literature more than anything else and became popular world wide. Is that what you’re referring to in terms of art? "I think their art in terms of realism blossomed in literature more than anything else and became popular world wide. Is that what you’re referring to in terms of art?" I am saying that there is nothing contradictory between prosperity and culture, and that in the best case scenario the two work together. Ancient Athens comes to mind, but they also had slaves so I don’t know where that fits into the picture. In your opinion, because I can’t tell from your post, is good art being produced today? This is how I interpret your post. Correct me if I have it wrong. As I understand it what you’re saying is that supply of art is undermined by interference in the demand. This suggests the world of artists and production of art is being perverted by someone or something, and that the work produced is not the work people want. You also seem to suggest that the consumption of art should be at a higher level, that people would buy more art if they could relate to it. This then means the art produced should be consumer driven, then it will be ‘real’ artwork. If that happens then it becomes a commodity. But I think we already have that with the books, films and music available today. First of all, I don’t think the world needs more art. But it always needs good art. The thousands of best seller books (airport lounge) compared to what we regard as literature, is not art, and neither are all the works turned out in the same way in music or the visual arts. That’s just commerce. There’s nothing wrong with that, it serves a market, and its popularity and production costs make it affordable for the people who want that. The number of great works of every era are very slim. The nature of the work itself means that the artist can only produce so much if it, and even then its quality varies from work to work. I don’t think great work needs money to come into being. Writers produce their work before they know if it will be picked up by a publisher, (Though for some time writers have received big advances to create that work.), visual artists prepare their work before a gallery accepts it (again, except for those who have a following. So this is virtually commerce). Artists, being what they are, are compelled to produce work regardless of the future. So I can’t see how creating a demand for art necessarily leads to good art being produced. If you purposely work this out by demand then it’s a commercial transaction and we already have that. Nor can you create a demand for good work, because one of the qualities of good work is its originality, which can’t be anticipated. Some good art is being produced today. Some of it is appreciated and some is not. Do you actually read these posts. Rather than starting with a presumed definition of 'art' and then pontificating about its current status in comparison with previous eras, its useful to note how the meaning of art changes along with cultural shifts. For instance , Lets look at the world today vs the 1920's. The amount of wealth is astronomically higher than it was, and in the hand of individuals in a greater number of countries. This means art as an investment is more important than it has been before , and this has spanned a culture of rapid commoditization. Every large and mid-sized city has a thriving arts scene today as more money is drawn into urban culture. Meanwhile, the definition of art is more fluid than it was in the 1920's. performance, event, installation, political expression, and much more can be called art today. Today's individualizing technologies splinter artistic communities into infinite subgroups so that there are no longer dominant determinations of what constitutes a movement or trend. You can find art everywhere but your determination of worth and category will differ from your neighbor's. "Can you explain this for me?" Treating artistic interest as psychopathology results in a hideous waste of resources in "treating" people capable of artistic output, as well as in a giant waste of potential when such can be utilized to create something like 1920s America or Renaissance Italy. The result is bad for everyone except people who profiteer from this arrangement. " As I understand it what you’re saying is that supply of art is undermined by interference in the demand. This suggests the world of artists and production of art is being perverted by someone or something, and that the work produced is not the work people want. You also seem to suggest that the consumption of art should be at a higher level, that people would buy more art if they could relate to it." Basically, when people have no value for the arts, there is inadequate demand for the arts. The problem is compounded by the wrongful movements in art scene itself. "The number of great works of every era are very slim. The nature of the work itself means that the artist can only produce so much if it, and even then its quality varies from work to work." "So I can’t see how creating a demand for art necessarily leads to good art being produced. If you purposely work this out by demand then it’s a commercial transaction and we already have that. Nor can you create a demand for good work, because one of the qualities of good work is its originality, which can’t be anticipated." I am not saying that demand for art would lead to good art being produced. That is up to the artist. Demand for art will however make it possible for more people to make their ends meet as artists. As for good art, that once again is up to the artist. We need to move away from avant garde and postmodernism and produce art that actually achieves things such as beauty and passion. I don’t think he does with much enthusiasm. He doesn’t seem interested in the Socratic dialogue of philosophy. He’s more interested in pontificating than having a discussion. He doesn’t need to engage. He has money. Wider cultural appreciation of fine art may be at an all-time low, which has several contributing factors behind it. "Art world" type post-modern works may be too divorced from aesthetic sensibility to appeal to most people, and there is an over-abundance of "lowbrow" entertainment. Certainly, people are far more distracted now than they've ever been- it's much easier for most people to sit in front of their tv/computer than to read a thought-provoking book or look at paintings. But people on the whole haven't changed fundamentally, appreciation of art was always something possessed by a minority of people, not the majority. The average person in the past didn't have much more contact with or appreciation for art outside a religious context, appreciation for high art and such is something that is most often cultivated by oneself or inherited by experience, and most people don't really grow up being taken to art galleries or having paintings in their homes. Still, art in all forms is still being bought and appreciated by people substantially- it just isn't in most people's line of sight. Does moral anti-realism change anything?
one claim constantly made about artistically inclined people is that they lack realism. my response to that is that reality of human world is what people make of it; and such things are only unrealistic if people choose to make them so. if something is not in demand, then those who are willing to supply it either go starving or have to do something else. the problem is not with those who are willing to form the supply, but with those who undermine the demand. i see no reason at all why america, with 300 million people and per capita gdp of $50,000 a year, should have less good art than renaissance italy, with 3 million people and per capita gdp of $1,500 a year. the problem is not with realism or lack of realism. the problem is one of values. clearly there have been times in history in which it was completely realistic to produce and distribute art. and the times and places where that was the case are the times and places to which we continue to look back now. so now we’ve come to a completely ridiculous point: seeing artistic interest as psychopathology. you might as well say that it’s pathological to want to make money or to worship god. treating such things as a psychopathology takes more resources than it would take to allow such people to be artists, and it does not produce any kind of benefit. there have been times in american history when that was not the attitude. in 1920s there was a magnificent artistic blossoming even at the same time as there was a great economic boom. economic prosperity and artistic blossoming coexisted. they worked together with one another. and it was in this time – one that combined economic prosperity with artistic excellence – that america became the greatest country in the world. this means the following. not only is it completely realistic to produce – and consume – art, but doing so is fully consistent with america’s values and america’s greatness. it is not for “snobs” or “liberal elites” or “pretentious europeans.” it is something that has been done by patriotic americans at the time that america rose to its greatest glory. it is fully realistic, as well as completely american, to produce and to consume art. the problem is lack of demand. the solution is increasing the demand while also producing supply of good art that people want to buy. hi. i'd like to suggest that tv/movies are the dominant forms of art these days, and that just about everyone loves some kind of tv or movie. the demand is great. the product is sometimes great. and, for a few, the profit is great. for consumers the situation is arguably better than ever. for producers however the situation is arguably more difficult than ever. perhaps i'm the best actor, director, or writer in my town or mid-sized city. i may still be uninteresting to a consumer who takes seeing the very best actors, directors, and writers in the world for granted. of course it's possible that i'm ahead of my time, but this is probably the 'unrealistic' fantasy that many critics of the artistic personality have in mind. i'm far more likely to be behind my time than ahead of it, and i am less willing to explore that possibility than the consumer whose money i want. from such a perspective, it's more realistic (safer) to learn a technical skill that is clearly in demand in my pursuit of making a living and achieving status. i realize you may have had paintings and sculpture foremost in your mind, but i suggest that those are just not the forms of our electronic time. one of the real problems in the art world is that art is often used simply as a way to invest money; it is also sometimes used for money laundering. this can lead to artists, who make their art look esoteric,and bound up in some kind of mysterious high-minded philosophy which is hard to criticised, more popular...these paintings, sculptures etc, are worth millions, and there has to be a way to defend these high prices. and the defence opted for is in something which is portrayed as being beyond the understanding of mere ordinary people....this process also has the feedback effect of making rich people seem highly sophisticated, and above everybody else.....this approach to art is simply a bubble which needs popping. can you explain how this solution might work? or why it would be a good thing if it did work. criticizing artworks for a lack of realism is a pet peeve of mine. i call it the "realism fetish." the solution is increasing the demand while also producing supply of good art that people want to buy. well, for one, it would give a sense of purpose to the millions of the so-called mentally ill in this country who otherwise are undervalued or devalued by society. western culture is highly materialistic/rationalistic. how do you increase aesthetic values in such a cultural environment? good question. i don’t know, and i don’t know if it’s possible in this society where corporate profits are of paramount importance. "western culture is highly materialistic/rationalistic. how do you increase aesthetic values in such a cultural environment?" look back to 1920s and the italian renaissance. in both situations there was economic boom and cultural blossoming. "can you explain how this solution might work? or why it would be a good thing if it did work." it can work because it has worked in the past. it was called 1920s. it is desirable because we will see a vast legacy of beauty being created, and with it a golden age that people will cherish for ages to come. i’m not sure where the benefit lies in this for people today, unless you’re saying it will lead to an economic boom. i can’t find your connection between art and the economy, if that’s your point? but using the twenties as an example doesn’t help me either. the art movements that dominated the world were not from america but from europe, and i had always though america’s greatness peaked after wwii. edit: though the twenties were obviously a hedonistic age for americans, so i take your point there. i think their art in terms of realism blossomed in literature more than anything else and became popular world wide. is that what you’re referring to in terms of art? "i think their art in terms of realism blossomed in literature more than anything else and became popular world wide. is that what you’re referring to in terms of art?" i am saying that there is nothing contradictory between prosperity and culture, and that in the best case scenario the two work together. ancient athens comes to mind, but they also had slaves so i don’t know where that fits into the picture. in your opinion, because i can’t tell from your post, is good art being produced today? this is how i interpret your post. correct me if i have it wrong. as i understand it what you’re saying is that supply of art is undermined by interference in the demand. this suggests the world of artists and production of art is being perverted by someone or something, and that the work produced is not the work people want. you also seem to suggest that the consumption of art should be at a higher level, that people would buy more art if they could relate to it. this then means the art produced should be consumer driven, then it will be ‘real’ artwork. if that happens then it becomes a commodity. but i think we already have that with the books, films and music available today. first of all, i don’t think the world needs more art. but it always needs good art. the thousands of best seller books (airport lounge) compared to what we regard as literature, is not art, and neither are all the works turned out in the same way in music or the visual arts. that’s just commerce. there’s nothing wrong with that, it serves a market, and its popularity and production costs make it affordable for the people who want that. the number of great works of every era are very slim. the nature of the work itself means that the artist can only produce so much if it, and even then its quality varies from work to work. i don’t think great work needs money to come into being. writers produce their work before they know if it will be picked up by a publisher, (though for some time writers have received big advances to create that work.), visual artists prepare their work before a gallery accepts it (again, except for those who have a following. so this is virtually commerce). artists, being what they are, are compelled to produce work regardless of the future. so i can’t see how creating a demand for art necessarily leads to good art being produced. if you purposely work this out by demand then it’s a commercial transaction and we already have that. nor can you create a demand for good work, because one of the qualities of good work is its originality, which can’t be anticipated. some good art is being produced today. some of it is appreciated and some is not. do you actually read these posts. rather than starting with a presumed definition of 'art' and then pontificating about its current status in comparison with previous eras, its useful to note how the meaning of art changes along with cultural shifts. for instance , lets look at the world today vs the 1920's. the amount of wealth is astronomically higher than it was, and in the hand of individuals in a greater number of countries. this means art as an investment is more important than it has been before , and this has spanned a culture of rapid commoditization. every large and mid-sized city has a thriving arts scene today as more money is drawn into urban culture. meanwhile, the definition of art is more fluid than it was in the 1920's. performance, event, installation, political expression, and much more can be called art today. today's individualizing technologies splinter artistic communities into infinite subgroups so that there are no longer dominant determinations of what constitutes a movement or trend. you can find art everywhere but your determination of worth and category will differ from your neighbor's. "can you explain this for me?" treating artistic interest as psychopathology results in a hideous waste of resources in "treating" people capable of artistic output, as well as in a giant waste of potential when such can be utilized to create something like 1920s america or renaissance italy. the result is bad for everyone except people who profiteer from this arrangement. " as i understand it what you’re saying is that supply of art is undermined by interference in the demand. this suggests the world of artists and production of art is being perverted by someone or something, and that the work produced is not the work people want. you also seem to suggest that the consumption of art should be at a higher level, that people would buy more art if they could relate to it." basically, when people have no value for the arts, there is inadequate demand for the arts. the problem is compounded by the wrongful movements in art scene itself. "the number of great works of every era are very slim. the nature of the work itself means that the artist can only produce so much if it, and even then its quality varies from work to work." "so i can’t see how creating a demand for art necessarily leads to good art being produced. if you purposely work this out by demand then it’s a commercial transaction and we already have that. nor can you create a demand for good work, because one of the qualities of good work is its originality, which can’t be anticipated." i am not saying that demand for art would lead to good art being produced. that is up to the artist. demand for art will however make it possible for more people to make their ends meet as artists. as for good art, that once again is up to the artist. we need to move away from avant garde and postmodernism and produce art that actually achieves things such as beauty and passion. i don’t think he does with much enthusiasm. he doesn’t seem interested in the socratic dialogue of philosophy. he’s more interested in pontificating than having a discussion. he doesn’t need to engage. he has money. wider cultural appreciation of fine art may be at an all-time low, which has several contributing factors behind it. "art world" type post-modern works may be too divorced from aesthetic sensibility to appeal to most people, and there is an over-abundance of "lowbrow" entertainment. certainly, people are far more distracted now than they've ever been- it's much easier for most people to sit in front of their tv/computer than to read a thought-provoking book or look at paintings. but people on the whole haven't changed fundamentally, appreciation of art was always something possessed by a minority of people, not the majority. the average person in the past didn't have much more contact with or appreciation for art outside a religious context, appreciation for high art and such is something that is most often cultivated by oneself or inherited by experience, and most people don't really grow up being taken to art galleries or having paintings in their homes. still, art in all forms is still being bought and appreciated by people substantially- it just isn't in most people's line of sight. does moral anti-realism change anything?
Check out these chicks, getting ready for the set and so on. Yeah some fine asses like these one are sure gonna make one hell of a photo session. The countryside landscape is beautiful and the girls fit in great! The playing around is over and we get into more serious stuff as the beauties get naked! Download full-length 24min 33sec movie now!
check out these chicks, getting ready for the set and so on. yeah some fine asses like these one are sure gonna make one hell of a photo session. the countryside landscape is beautiful and the girls fit in great! the playing around is over and we get into more serious stuff as the beauties get naked! download full-length 24min 33sec movie now!
February | 2009 | Lipogram! Scorecard! Sometimes the biggest news is when there isn’t news. The possibility of no news, ever, would be in itself newsworthy. But when you see “news,” feeling like it should be more newsworthy? Like you should feel more? Bonds Junior tested positive for steroids in 2000 or 2001, or both, suggest newly-public U. S. court documents. Did this surprise someone? I suppose so. Did it surprise me? Not too much. Despite “innocent until proven guilty,” true proof is outside the court’s powers to produce. Only numbers could do so, sterile theorems mostly useless in the outside world. So we look for guilt beyond (hopefully one specific) threshold of doubt. Suspicion of Bonds didn’t begin this week, though. There’s something inside us which doesn’t need proof. The bigger it is in some given person, the less this “news” is news to them. The opposite is true too. I resented Bonds before he hit his seven hundred fifty-sixth home run. The erosion of the long-term record did not offend but unsettle me. Someone I’d seen compete, up there with the historic legends? It didn’t seem possible. Why did I resent him, then? He could outslug history without truly upsetting me. But he’d outshone the heroes who first drew me to the sport too. Then, he’d crossed some line. He couldn’t help being the best (or could he?), but neither did I try to stop my petty scorn. In the Wheel of Time series of novels, five youths set out from their tiny home of Emond’s Field. In the first book, we find out three of them wield the “One Power.” Subsequent books tell us their strength is the most seen in centuries. But following those books comes the knowledge of even more powerful people. With the glut of new monikers to remember, the series got more difficult to enjoy. The problem included this disillusionment; with the lines between countries blurred, more prodigies could be discovered. Old rules of the mystic forces governing the universe were no longer true. To the extent of destroying outmoded ideologies, this is fine. But when this process infringes upon your own memories, dimming them, then it’s fine for you to criticize it. For the Wheel of Time people, it built up to the end of the world they’d known. For me, it could turn me vindictive, looking for excuses for Bonds’ success. They were duly found. But did I truly seek them? Roger Clemens joined Bonds in the “news” which might not be. The list of suspects is long enough if not more. It includes my onetime heroes. Some retire without getting close to Cooperstown. Others would like to return; I roll my eyes. So when I noticed those records, I did feel some emotion I don’t enjoy feeling. My belief in old sluggers is strong. My belief in innocence is even stronger. FAQ? Not so. Qs? Okay. FA? Assuming you thoroughly look at this post, probably not. So…on with it! It’s not my real one. What is your real one? If I was going to tell you, would I have identified myself under a pseudonym earlier? Hey, I’m supposed to be asking the questions! Sports. But I’m not another sports blogger. Read the subtitle, please. Mostly baseball, or hockey if the muse strikes me. How often has the hockey muse struck you? In my life? Two times…maybe three. The Cubs, the Twins, or whoever else I feel like. Hmm. If you must ask, this blog might not work for you. But who am I to say? A man working at an MLB stadium didn’t know, so if you don’t, that’s okay. All right, smarty pants, what’s a lipogram? Now that’s a good inquiry! A lipogram is a work of writing that omits a particular symbol, such as my words in italics in this post. A Z-lipogram is trivial, but I flourish in difficulty such as omitting our fifth symbol of 26. So everything you write will leave out the letter E? Uh, no. This post doesn’t. Oh yeah, I’m supposed to read the subtitle. Wait, iamb? Did you spell that wrong? Check out http://humbug.baseballtoaster.com/, where I blogged for most of the last two years alongside dianagramr and the Score Bard. The Toaster is…erm, soon to be toast, so I’ll be blogging here from now on. Or until I stop. Or move. But your melodramatic incomprehensibility is no match for the Bard’s inimitable repartee! Of course not. That’s why this is the Lipogram Scorecard…poetry will not be the be-all, end-all. Hopefully I’ll get to try lots of different styles. Send me an e-mail at graciebarn256 AT gmail DOT com. That’s not my real name either. Oh I get it. Not only are you a wannabe-formalist who thrives on outmoded concepts like rhyme, you also like powers of 2 and their binary duality. Don’t you know you’re living in the modern age, where not everything is black and white? I’m a baseball fan. I have a right to nostalgia. This is my blog. Thanks for coming by! Coming soon: an introductory FAQ.
february | 2009 | lipogram! scorecard! sometimes the biggest news is when there isn’t news. the possibility of no news, ever, would be in itself newsworthy. but when you see “news,” feeling like it should be more newsworthy? like you should feel more? bonds junior tested positive for steroids in 2000 or 2001, or both, suggest newly-public u. s. court documents. did this surprise someone? i suppose so. did it surprise me? not too much. despite “innocent until proven guilty,” true proof is outside the court’s powers to produce. only numbers could do so, sterile theorems mostly useless in the outside world. so we look for guilt beyond (hopefully one specific) threshold of doubt. suspicion of bonds didn’t begin this week, though. there’s something inside us which doesn’t need proof. the bigger it is in some given person, the less this “news” is news to them. the opposite is true too. i resented bonds before he hit his seven hundred fifty-sixth home run. the erosion of the long-term record did not offend but unsettle me. someone i’d seen compete, up there with the historic legends? it didn’t seem possible. why did i resent him, then? he could outslug history without truly upsetting me. but he’d outshone the heroes who first drew me to the sport too. then, he’d crossed some line. he couldn’t help being the best (or could he?), but neither did i try to stop my petty scorn. in the wheel of time series of novels, five youths set out from their tiny home of emond’s field. in the first book, we find out three of them wield the “one power.” subsequent books tell us their strength is the most seen in centuries. but following those books comes the knowledge of even more powerful people. with the glut of new monikers to remember, the series got more difficult to enjoy. the problem included this disillusionment; with the lines between countries blurred, more prodigies could be discovered. old rules of the mystic forces governing the universe were no longer true. to the extent of destroying outmoded ideologies, this is fine. but when this process infringes upon your own memories, dimming them, then it’s fine for you to criticize it. for the wheel of time people, it built up to the end of the world they’d known. for me, it could turn me vindictive, looking for excuses for bonds’ success. they were duly found. but did i truly seek them? roger clemens joined bonds in the “news” which might not be. the list of suspects is long enough if not more. it includes my onetime heroes. some retire without getting close to cooperstown. others would like to return; i roll my eyes. so when i noticed those records, i did feel some emotion i don’t enjoy feeling. my belief in old sluggers is strong. my belief in innocence is even stronger. faq? not so. qs? okay. fa? assuming you thoroughly look at this post, probably not. so…on with it! it’s not my real one. what is your real one? if i was going to tell you, would i have identified myself under a pseudonym earlier? hey, i’m supposed to be asking the questions! sports. but i’m not another sports blogger. read the subtitle, please. mostly baseball, or hockey if the muse strikes me. how often has the hockey muse struck you? in my life? two times…maybe three. the cubs, the twins, or whoever else i feel like. hmm. if you must ask, this blog might not work for you. but who am i to say? a man working at an mlb stadium didn’t know, so if you don’t, that’s okay. all right, smarty pants, what’s a lipogram? now that’s a good inquiry! a lipogram is a work of writing that omits a particular symbol, such as my words in italics in this post. a z-lipogram is trivial, but i flourish in difficulty such as omitting our fifth symbol of 26. so everything you write will leave out the letter e? uh, no. this post doesn’t. oh yeah, i’m supposed to read the subtitle. wait, iamb? did you spell that wrong? check out http://humbug.baseballtoaster.com/, where i blogged for most of the last two years alongside dianagramr and the score bard. the toaster is…erm, soon to be toast, so i’ll be blogging here from now on. or until i stop. or move. but your melodramatic incomprehensibility is no match for the bard’s inimitable repartee! of course not. that’s why this is the lipogram scorecard…poetry will not be the be-all, end-all. hopefully i’ll get to try lots of different styles. send me an e-mail at graciebarn256 at gmail dot com. that’s not my real name either. oh i get it. not only are you a wannabe-formalist who thrives on outmoded concepts like rhyme, you also like powers of 2 and their binary duality. don’t you know you’re living in the modern age, where not everything is black and white? i’m a baseball fan. i have a right to nostalgia. this is my blog. thanks for coming by! coming soon: an introductory faq.
As recently promised, I have finished a short article about online Texas Hold ‘Em outlining how you can use the greed of the burgeoning industry to rake in cash and prizes. This entry was posted on Saturday, August 6th, 2005, 9:06 pm and is filed under Everything Else. You can follow any responses to this entry through RSS 2.0. You can leave a response, or trackback from your own site.
as recently promised, i have finished a short article about online texas hold ‘em outlining how you can use the greed of the burgeoning industry to rake in cash and prizes. this entry was posted on saturday, august 6th, 2005, 9:06 pm and is filed under everything else. you can follow any responses to this entry through rss 2.0. you can leave a response, or trackback from your own site.
The all-time leading points scorer in the Aviva Premiership enjoyed a career in professional rugby lasting over 15 years. Andy is now a commentator, pundit and co-presenter of the Rugby Pod with fellow ambassador Jim Hamilton. Andy has been a dedicated supporter of the Matt Hampson Foundation and in 2017 pledged to come out of retirement for any club that could raise or donate £10,000 to the Matt Hampson Foundation. A feat completed by the London Cornish Rugby Club in May 2017.
the all-time leading points scorer in the aviva premiership enjoyed a career in professional rugby lasting over 15 years. andy is now a commentator, pundit and co-presenter of the rugby pod with fellow ambassador jim hamilton. andy has been a dedicated supporter of the matt hampson foundation and in 2017 pledged to come out of retirement for any club that could raise or donate £10,000 to the matt hampson foundation. a feat completed by the london cornish rugby club in may 2017.
Being a gun enthusiast, you will want to make sure that your gear has the right accessories and parts you can use on it. In regards to that, it wouldn’t be too exciting if you don’t give your own personal assault rifle your own unique touch with the accessories available for it. Buying parts for your gun may be something that seems easy, but you’ll want to find a good gun shop to help you with that in the first place. Searching for the right gun shop is something that you can do online today. This is due to the fact that most of them already have their own web pages. If your goal is to ensure that you get the accessories that you need from the gun shop, then you’ll have to consider some things first. With all the gun shops that are out there, you should know that you’ll have to find the one that you can rely on. Keep in mind that there are certain things to follow when you have to determine a gun shop’s reliability. As a gun shop, they should also be able to provide thorough customer service when needed. With the help of gun experts, you can also rely on their recommendations and referrals when it comes to finding the best gun shop in your area. Also, you’d want to ask the gun store beforehand whether or not they are receiving quality grade accessories and parts for guns. Taking notice of the delivery service of the gun store is also something that you should do. Professionalism is an important thing forsaken business and you’ll have to know the history of the gun store before buying their products. Also, if you’re looking to purchase new guns or old ones, a good gun shop should have most of them. In order to ensure that your shooting practice will always be at peak, you’ll want to get the gear that you need from a reliable gun store. Also, there are gun shops out there that can provide you the survival tools that you need should you prefer to purchase them. Another important thing to remember about this is that you have to see if you’re allowed to possess certain gun parts and accessories. In the end, it all comes down to whether or not you’ll be allowed to possess firearms in your country. In any event, you’d want to keep yourself out trouble and that the gun shop owner would still provide you the parts that you’re allowed to use.
being a gun enthusiast, you will want to make sure that your gear has the right accessories and parts you can use on it. in regards to that, it wouldn’t be too exciting if you don’t give your own personal assault rifle your own unique touch with the accessories available for it. buying parts for your gun may be something that seems easy, but you’ll want to find a good gun shop to help you with that in the first place. searching for the right gun shop is something that you can do online today. this is due to the fact that most of them already have their own web pages. if your goal is to ensure that you get the accessories that you need from the gun shop, then you’ll have to consider some things first. with all the gun shops that are out there, you should know that you’ll have to find the one that you can rely on. keep in mind that there are certain things to follow when you have to determine a gun shop’s reliability. as a gun shop, they should also be able to provide thorough customer service when needed. with the help of gun experts, you can also rely on their recommendations and referrals when it comes to finding the best gun shop in your area. also, you’d want to ask the gun store beforehand whether or not they are receiving quality grade accessories and parts for guns. taking notice of the delivery service of the gun store is also something that you should do. professionalism is an important thing forsaken business and you’ll have to know the history of the gun store before buying their products. also, if you’re looking to purchase new guns or old ones, a good gun shop should have most of them. in order to ensure that your shooting practice will always be at peak, you’ll want to get the gear that you need from a reliable gun store. also, there are gun shops out there that can provide you the survival tools that you need should you prefer to purchase them. another important thing to remember about this is that you have to see if you’re allowed to possess certain gun parts and accessories. in the end, it all comes down to whether or not you’ll be allowed to possess firearms in your country. in any event, you’d want to keep yourself out trouble and that the gun shop owner would still provide you the parts that you’re allowed to use.
italian dining chairs modern fine set of twelve for sale. 16 pc dinnerware piece set service for 4. best outdoor lighted christmas decorations star decoration fresh lights of. dining room tables round with leaf pedestal kitchen table and chairs large. wooden outdoor bench old worn garden model obj 1. decorative outdoor pillows full size of bedrooms for rent in and more warehouse patio pillow. outdoor chaise lounge sale free shipping today within decoration wicker patio furniture elegant espresso brown 6 piece throughout 0 from. outdoor chaise lounge chairs sale chair best.
italian dining chairs modern fine set of twelve for sale. 16 pc dinnerware piece set service for 4. best outdoor lighted christmas decorations star decoration fresh lights of. dining room tables round with leaf pedestal kitchen table and chairs large. wooden outdoor bench old worn garden model obj 1. decorative outdoor pillows full size of bedrooms for rent in and more warehouse patio pillow. outdoor chaise lounge sale free shipping today within decoration wicker patio furniture elegant espresso brown 6 piece throughout 0 from. outdoor chaise lounge chairs sale chair best.
DISCLAIMER of MacRae Family Dentistry and MH Sub I, LLC as hosting company dba Baystone Media. MacRae Family Dentistry and Baystone Media expressly disclaim all warranties and responsibilities of any kind, whether express or implied, for the accuracy or reliability of the content of any information contained in this site, and for the suitability, results, effectiveness or fitness for any particular purpose of the content. You are solely responsible for your use or reliance on such information and any foreseeable or unforeseeable consequences arising out of such use or reliance. In no event will MacRae Family Dentistry or Baystone Media be liable for any damages resulting from the use of or inability to use, the content, whether based on warranty, contract, tort or other legal theory, and whether or not MacRae Family Dentistry or Baystone Media is advised of the possibility of such damages. In no event will MacRae Family Dentistry’s and Baystone Media’s aggregate liability exceed U.S. $100.
disclaimer of macrae family dentistry and mh sub i, llc as hosting company dba baystone media. macrae family dentistry and baystone media expressly disclaim all warranties and responsibilities of any kind, whether express or implied, for the accuracy or reliability of the content of any information contained in this site, and for the suitability, results, effectiveness or fitness for any particular purpose of the content. you are solely responsible for your use or reliance on such information and any foreseeable or unforeseeable consequences arising out of such use or reliance. in no event will macrae family dentistry or baystone media be liable for any damages resulting from the use of or inability to use, the content, whether based on warranty, contract, tort or other legal theory, and whether or not macrae family dentistry or baystone media is advised of the possibility of such damages. in no event will macrae family dentistry’s and baystone media’s aggregate liability exceed u.s. $100.
Connect with Us - Muhlenkamp and Company, Inc. Connect with Us - Muhlenkamp and Company, Inc. Please call (877)935-5520 x 4 or (724)935-5520 x 4. How did you hear about Muhlenkamp & Company? Would you like to receive our quarterly newsletter and announcements via email? Would you like to receive a copy of Muhlenkamp Marathon Financial Training Workbook? Would you like to receive a copy of Reflecting over 40 Years—Lessons Learned and Changes Observed? We are located in the northern suburbs of the city of Pittsburgh in Wexford, Pennsylvania. Our office is open from 8:30 a.m. until 5:00 p.m., Monday through Friday. Please call us to schedule a visit or click our address below to get directions to our location.
connect with us - muhlenkamp and company, inc. connect with us - muhlenkamp and company, inc. please call (877)935-5520 x 4 or (724)935-5520 x 4. how did you hear about muhlenkamp & company? would you like to receive our quarterly newsletter and announcements via email? would you like to receive a copy of muhlenkamp marathon financial training workbook? would you like to receive a copy of reflecting over 40 years—lessons learned and changes observed? we are located in the northern suburbs of the city of pittsburgh in wexford, pennsylvania. our office is open from 8:30 a.m. until 5:00 p.m., monday through friday. please call us to schedule a visit or click our address below to get directions to our location.
This group is made of the finest bookbinding tradition with heavy board covers, turned edge panel linings, and square comers. The TABLE TENTS are made with padded board and 4 corner liners are done in the same material as the cover. Only the finest ribbon is used joining, the 2 panels.
this group is made of the finest bookbinding tradition with heavy board covers, turned edge panel linings, and square comers. the table tents are made with padded board and 4 corner liners are done in the same material as the cover. only the finest ribbon is used joining, the 2 panels.
1 Sing vnto the Lord a newe song: sing vnto the Lord, all the earth. 2 Sing vnto the Lord, and prayse his Name: declare his saluation from day to day. 3 Declare his glory among all nations, and his wonders among all people. 4 For the Lord is great and much to be praysed: he is to be feared aboue all gods. 5 For all the gods of the people are idoles: but the Lord made the heauens. 6 Strength and glory are before him: power and beautie are in his Sanctuarie. 7 Giue vnto the Lord, ye families of the people: giue vnto the Lord glory and power. 8 Giue vnto the Lord the glory of his Name: bring an offering, and enter into his courtes. 9 Worship the Lord in the glorious Sanctuarie: tremble before him all the earth. 10 Say among the nations, The Lord reigneth: surely the world shalbe stable, and not moue, and he shall iudge the people in righteousnesse. 11 Let the heauens reioyce, and let the earth be glad: let the sea roare, and all that therein is. 13 Before the Lord: for he commeth, for he cometh to iudge the earth: he wil iudge the world with righteousnes, and the people in his trueth.
1 sing vnto the lord a newe song: sing vnto the lord, all the earth. 2 sing vnto the lord, and prayse his name: declare his saluation from day to day. 3 declare his glory among all nations, and his wonders among all people. 4 for the lord is great and much to be praysed: he is to be feared aboue all gods. 5 for all the gods of the people are idoles: but the lord made the heauens. 6 strength and glory are before him: power and beautie are in his sanctuarie. 7 giue vnto the lord, ye families of the people: giue vnto the lord glory and power. 8 giue vnto the lord the glory of his name: bring an offering, and enter into his courtes. 9 worship the lord in the glorious sanctuarie: tremble before him all the earth. 10 say among the nations, the lord reigneth: surely the world shalbe stable, and not moue, and he shall iudge the people in righteousnesse. 11 let the heauens reioyce, and let the earth be glad: let the sea roare, and all that therein is. 13 before the lord: for he commeth, for he cometh to iudge the earth: he wil iudge the world with righteousnes, and the people in his trueth.
Test the forest’s strength. Figure out which trees will hold your weight and which branches will snap with one wrong step, sending you crashing to the ground with two scraped elbows and a temporary but passionate fear of heights. Find the warm spots of sunlight where no one will interrupt your soliloquies. After all, the only way to make yourself a home somewhere is to go out there and find it. It’s time to come Out of the Closet!™ Are you looking for a way to start a difficult conversation with a family member? Do you like taking on controversial topics and confronting scandalous stereotypes? Whether you’re gay, bisexual, genderqueer, or just a good ol’ Ally looking for validation, Out of the Closet!™ is a game that will have everyone talking (and passing judgment!) for years. and you are not listening anymore. Astrid digs her fingernails into the bar of soap, making tiny half-moon puckers in the glossy white surface, then sets it back down on the lip of the tub. Above her, the showerhead sputters. The heat falters and edges toward lukewarm. At times I feel quite at odds with my old self, when the name appears on my bank statements and a sudden wave of cognitive dissonance makes me briefly forget where I am. It’s so easy, especially in the narrative of identity that recent discourse has created, to see your origin as your enemy. What have I been doing if not running away from that ghost at full speed? When I go to the beach nowadays, I spend most of my time on land: scrambling across rocks, peering into tide pools, picking up bits of kelp and threading the rubbery strands through my fingers. I used to be a total water kid. I wanted nothing to do with the sand and sun, instead spending my time bobbing up and down with the motion of the waves and seeing how long I could hold my breath. My hands might tremble, but the pads of my fingers are steady as I hit the nonexistent buttons I’ve memorized by touch, more familiar than my own body. I let the letters fall into place and then I gently tap the blue rounded square and then it’s out there, throbbing like a papercut behind the glass. When capitalist systems fail, the restoration of the environment falls almost exclusively on the people whose culture and lives have been equally exploited. They have lost their environmental self-determination and ability to define the human-nature relationship, left only with a collective cultural memory of what has been lost. To walk past the mirrors with eyes squeezed shut is the only option, because the alternative is to get caught in the reflection and stare in heart-beating terror, paralyzed by my own reality and unreality. I know too well the persistently imperfect lines of myself, and I know that refusing to look does not make them any less real, but what other option did I have? Dysphoria cannot be made into a story, and it does not come with an instruction manual. The crowds cheered uproariously, whistling and raising their fists to the sky, and I knew I was supposed to join them. After all, wasn’t this a victory? But at that moment, all I could feel was weariness: a bone-deep exhaustion at the reminder of what had almost come to pass, paired with a sense of trepidation of what would come next. I don’t believe in a god but I believe in the cycles of life; I believe in the invisible energy that holds us all together and inspires me to bend down, bury my fingers in the dirt, let myself feel the pulsating heartbeat of creation–not ‘created by’, but creating and recreating itself and us through night and day and rain and sun and summer and winter. I believe that these seeds have just as much power as any real or imagined deity. until it is so tiny i could put it in my mouth and swallow. I promise you that I didn’t mean to do this to you. This…. this wasn’t supposed to happen. I had no idea you would be here. But you are, and neither of us can leave now, so can you please let me try? You know who is the only person left in the world, in my world at least? You. And maybe I’ve never met you before, but that doesn’t matter because you are all that I have.
test the forest’s strength. figure out which trees will hold your weight and which branches will snap with one wrong step, sending you crashing to the ground with two scraped elbows and a temporary but passionate fear of heights. find the warm spots of sunlight where no one will interrupt your soliloquies. after all, the only way to make yourself a home somewhere is to go out there and find it. it’s time to come out of the closet!™ are you looking for a way to start a difficult conversation with a family member? do you like taking on controversial topics and confronting scandalous stereotypes? whether you’re gay, bisexual, genderqueer, or just a good ol’ ally looking for validation, out of the closet!™ is a game that will have everyone talking (and passing judgment!) for years. and you are not listening anymore. astrid digs her fingernails into the bar of soap, making tiny half-moon puckers in the glossy white surface, then sets it back down on the lip of the tub. above her, the showerhead sputters. the heat falters and edges toward lukewarm. at times i feel quite at odds with my old self, when the name appears on my bank statements and a sudden wave of cognitive dissonance makes me briefly forget where i am. it’s so easy, especially in the narrative of identity that recent discourse has created, to see your origin as your enemy. what have i been doing if not running away from that ghost at full speed? when i go to the beach nowadays, i spend most of my time on land: scrambling across rocks, peering into tide pools, picking up bits of kelp and threading the rubbery strands through my fingers. i used to be a total water kid. i wanted nothing to do with the sand and sun, instead spending my time bobbing up and down with the motion of the waves and seeing how long i could hold my breath. my hands might tremble, but the pads of my fingers are steady as i hit the nonexistent buttons i’ve memorized by touch, more familiar than my own body. i let the letters fall into place and then i gently tap the blue rounded square and then it’s out there, throbbing like a papercut behind the glass. when capitalist systems fail, the restoration of the environment falls almost exclusively on the people whose culture and lives have been equally exploited. they have lost their environmental self-determination and ability to define the human-nature relationship, left only with a collective cultural memory of what has been lost. to walk past the mirrors with eyes squeezed shut is the only option, because the alternative is to get caught in the reflection and stare in heart-beating terror, paralyzed by my own reality and unreality. i know too well the persistently imperfect lines of myself, and i know that refusing to look does not make them any less real, but what other option did i have? dysphoria cannot be made into a story, and it does not come with an instruction manual. the crowds cheered uproariously, whistling and raising their fists to the sky, and i knew i was supposed to join them. after all, wasn’t this a victory? but at that moment, all i could feel was weariness: a bone-deep exhaustion at the reminder of what had almost come to pass, paired with a sense of trepidation of what would come next. i don’t believe in a god but i believe in the cycles of life; i believe in the invisible energy that holds us all together and inspires me to bend down, bury my fingers in the dirt, let myself feel the pulsating heartbeat of creation–not ‘created by’, but creating and recreating itself and us through night and day and rain and sun and summer and winter. i believe that these seeds have just as much power as any real or imagined deity. until it is so tiny i could put it in my mouth and swallow. i promise you that i didn’t mean to do this to you. this…. this wasn’t supposed to happen. i had no idea you would be here. but you are, and neither of us can leave now, so can you please let me try? you know who is the only person left in the world, in my world at least? you. and maybe i’ve never met you before, but that doesn’t matter because you are all that i have.
On this website we recommend many designs abaout Fabulous Pumpkins Stencils Picture Ideas that we have collected from various sites home design, and of course what we recommend is the most excellent of design for Fabulous Pumpkins Stencils Picture Ideas. If you like the design on our website, please do not hesitate to visit again and get inspiration from all the houses in the design of our web design. And if you want to see more images more we recommend the gallery below, you can see the picture as a reference design from your Fabulous Pumpkins Stencils Picture Ideas. Thank you for seeing gallery of Fabulous Pumpkins Stencils Picture Ideas, we would be very happy if you come back. Gallery of "Fabulous Pumpkins Stencils Picture Ideas"
on this website we recommend many designs abaout fabulous pumpkins stencils picture ideas that we have collected from various sites home design, and of course what we recommend is the most excellent of design for fabulous pumpkins stencils picture ideas. if you like the design on our website, please do not hesitate to visit again and get inspiration from all the houses in the design of our web design. and if you want to see more images more we recommend the gallery below, you can see the picture as a reference design from your fabulous pumpkins stencils picture ideas. thank you for seeing gallery of fabulous pumpkins stencils picture ideas, we would be very happy if you come back. gallery of "fabulous pumpkins stencils picture ideas"
Long necklace composed of silver-plated pieces, joined in the central part by a tube from which multiple pieces hang like fringes. A jewel of boho chic style that includes dragonflies shaped pieces, which are the protagonist of the romantic collection "Sweetness". A necklace made in Spain by UNOde50 and 100% handmade.
long necklace composed of silver-plated pieces, joined in the central part by a tube from which multiple pieces hang like fringes. a jewel of boho chic style that includes dragonflies shaped pieces, which are the protagonist of the romantic collection "sweetness". a necklace made in spain by unode50 and 100% handmade.
Here are some of the 2017 winners from our catalog! Take a look at the 2017 Winners page for the full list. Don’t forget to contact the Southfield library to place items on hold if we don’t have a copy available right away! Together, a boy and his parents drive to the city of Havana, Cuba, in their old family car. Along the way, they experience the sights and sounds of the streets--neighbors talking, musicians performing, and beautiful, colorful cars putt-putting and bumpety-bumping along. In the end, though, it's their old car, Cara Cara, that the boy loves best. When Sunflower, a young city girl, moves to the countryside, she grows to love the reed marsh lands - the endlessly flowing river, the friendly buffalo with their strong backs and shiny, round heads, the sky that stretches on and on in its vastness. However, the days are long, and the little girl is lonely. Then she meets Bronze, who, unable to speak, is ostracized by the other village boys. Soon the pair are inseparable, and when Bronze's family agree to take Sunflower in, it seems that fate has brought him the sister he has always longed for. But life in Damaidi is hard, and Bronze's family can barely afford to feed themselves. Can the little city girl stay here, in this place where she has finally found happiness? A classic, heartwarming tale set to the backdrop of the Chinese cultural revolution. While gathering firewood, Yasuhiro comes upon an injured crane hidden in the snow. He rescues and comforts the bird, then watches it fly away. The next night, a mysterious young girl arrives at Yasuhiro's home seeking shelter from the cold. The boy and his father welcome the girl, named Hiroko, to stay with them. But when Hiroko notices that Yasuhiro's father is struggling to earn money, she offers to weave silk for him to sell. After the fabric fetches a good price, the boy's father becomes impatient for more silk, and his greed has a life-changing effect on them all. Lyrical storytelling deftly interwoven with original haiku create a magical adaptation of popular Japanese folktales--an inspirational story of friendship and the power of kindness to transform lives. Freedom. Mariah has barely dared to dream of it her entire life. When General Sherman’s march through Georgia during the Civil War passes the plantation where she is enslaved, her life changes instantly. Joining the march for protection, Mariah heads into the unknown, wondering if she can ever feel safe, if she will ever be able to put the brutalities of slavery behind her. On the march Mariah meets a young man named Caleb, and a new dream takes root—one of a future with a home of her own and a true love by her side. But hope often comes at a cost. As the treacherous march continues toward the churning waters of Ebenezer Creek, Mariah sees that the harsh realities of her and her peoples’ lives will always haunt them. Acclaimed poet Bao Phi delivers a powerful, honest glimpse into a relationship between father and son and between cultures, old and new. A Different Pond is an unforgettable story about a simple event--a long-ago fishing trip. As a young boy, Bao Phi awoke early, hours before his father's long workday began, to fish on the shores of a small pond in Minneapolis. Unlike many other anglers, Bao and his father fished for food, not recreation. A successful catch meant a fed family. Between hope-filled casts, Bao's father told him about a different pond in their homeland of Vietnam. The New York Times has said that Bao Phi's poetry "rhymes with the truth." Together with graphic novelist Thi Bui's striking, evocative art, Phi's expertly crafted prose reflects an immigrant family making its way in a new home while honoring its bonds to the past. For Arturo, summetime in Miami means playing basketball until dark, sipping mango smoothies, and keeping cool under banyan trees. And maybe a few shifts as junior lunchtime dishwasher at Abuela's restaurant. Maybe. But this summer also includes Carmen, a cute poetry enthusiast who moves into Arturo's apartment complex and turns his stomach into a deep fryer. He almost doesn't notice the smarmy land developer who rolls into town and threatens to change it. Arturo refuses to let his family and community go down without a fight, and as he schemes with Carmen, Arturo discovers the power of poetry and protest through untold family stories and the work of Jose Marti. The story of one of America’s most revered figures is brought to life by the text of award-winning author Walter Dean Myers and the sweeping, lush illustrations of artist Floyd Cooper. This sweet, rhyming counting book introduces young readers to numbers one through fifteen as Grandma's family and friends fill her tiny house on Brown Street. Neighbors, aunts, uncles, nieces, nephews, and grandkids crowd into the house and pile it high with treats for a family feast. Where there's a will there's a way when families grow and come together. In one day, four lives weave together in unexpected ways. Virgil Salinas is shy and kindhearted and feels out of place in his loud and boisterous family. Valencia Somerset, who is deaf, is smart, brave, and secretly lonely, and loves everything about nature. Kaori Tanaka is a self-proclaimed psychic, whose little sister Gen is always following her around. And Chet Bullens wishes the weird kids would just act normal so that he can concentrate on basketball. They aren’t friends -- at least not until Chet pulls a prank that traps Virgil and his pet guinea pig at the bottom of a well. This disaster leads Kaori, Gen, and Valencia on an epic quest to find the missing Virgil. Through luck, smarts, bravery, and a little help from the universe, a rescue is performed, a bully is put in his place, and friendship blooms. Fifteen-year-old Will has shoved a gun in the back waistband of his jeans. See, his brother Shawn was just murdered. And Will knows the rules. No crying. No snitching. Revenge. That’s where Will’s now heading, with that gun shoved in the back waistband of his jeans, the gun that was his brother’s gun. He gets on the elevator, seventh floor, stoked. He knows who he’s after. Or does he? As the elevator stops on the sixth floor, on comes Buck. Buck, Will finds out, is who gave Shawn the gun before Will took the gun. Buck tells Will to check that the gun is even loaded. And that’s when Will sees that one bullet is missing. And the only one who could have fired Shawn’s gun was Shawn. Huh. Will didn’t know that Shawn had ever actually USED his gun. Bigger huh. BUCK IS DEAD. But Buck’s in the elevator? Just as Will’s trying to think this through, the door to the next floor opens. A teenage girl gets on, waves away the smoke from Dead Buck’s cigarette. Will doesn’t know her, but she knew him. Knew. When they were eight. And stray bullets had cut through the playground, and Will had tried to cover her, but she was hit anyway, and so what she wants to know, on that fifth floor elevator stop, is, what if Will, Will with the gun shoved in the back waistband of his jeans, MISSES.. Miriam Makeba, a Grammy Award–winning South African singer, rose to fame in the hearts of her people at the pinnacle of apartheid―a brutal system of segregation similar to American Jim Crow laws. Mama Africa, as they called her, raised her voice to help combat these injustices at jazz clubs in Johannesburg; in exile, at a rally beside Dr. Martin Luther King, Jr.; and before the United Nations. "In the tradition of DELICIOUS, WIDENESS & WONDER, and EVERYBODY PAINTS!, this is Susan Goldman Rubin's extensively researched and very accessible biography of civic activist Maya Lin, most famous for her design of the Vietnam Veterans Memorial. The Vietnam Veterans Memorial in Washington, D.C., is one of the most famous pieces of civic architecture in the world. But most people are not as familiar with the reserved college student who entered and won the design competition to build it. This accessible biography tells the story of Maya Lin, from her struggle to stick with her vision of the memorial to the wide variety of works she has created since then. Illustrated extensively with photos and drawings, the carefully researched text crosses multiple interests--American history, civic activism, art history, and cultural diversity--and offers a timely celebration of the memorial's 35th anniversary, as well as contributing to the current, important discussion of the role of women and minorities in American society". Over the centuries, untold numbers of black men and women in America have achieved great things against the odds. Pathfinders is a collective biography of sixteen diverse American men and women of African descent who made their mark on American history in the 18th to 20th centuries. People who dared to dream, take risks, and create goals not only for themselves, but for others and the betterment of their society, too. Award-winning author Tonya Bolden offers an insightful look at these figures, from Venture Smith, who bought his freedom; to Sadie Alexander, who contributed to the Civil Rights movement in the United States; to Katherine Johnson, who helped the United States land on the moon. Jade believes she must get out of her neighborhood if she’s ever going to succeed. Her mother says she has to take every opportunity. She has. She accepted a scholarship to a mostly-white private school and even Saturday morning test prep opportunities. But some opportunities feel more demeaning than helpful. Like an invitation to join Women to Women, a mentor-ship program for “at-risk” girls. Except really, it’s for black girls. From “bad” neighborhoods. In luminous paintings and arresting poems, two of children's literature's top African-American scholars track Arturo Schomburg's quest to correct history. The adults in Casey's life embrace his interests, but Jessie isn't so sure. Boys aren't supposed to wear sparkly, shimmery, glittery things. Then, when older boys at the library tease Casey for wearing girl things, Jessie realizes that Casey has the right to be himself and wear whatever he wants. Why can't both she and Casey love all things shimmery, glittery, and sparkly? Here is a sweet, heartwarming story about acceptance, respect, and the freedom to be yourself in a world where any gender expression should be celebrated. Sparkly things are for everyone to enjoy! A boy tries to steer a safe path through the projects in Harlem in the wake of his brother's death. The White Rose is guarded closely by the gardener, who once caught a cold walking barefoot trying to find his shoes, which had been hidden by a cat, which was a gift from his younger brother, who was married to Dalva, who had inherited the cat from her uncle, who died of a broken heart awaiting a love letter that never arrived... Eventually, we see how one tiny action can have marvelous consequences, and the story turns like a ferris wheel. With a playful lightness of touch, Mello explores serious questions about the importance of kindness and the dangers of greed. Mello's illustrations will inspire his young readers, providing them with familiar and approachable images while encouraging imagination to fill in the narrative gaps, as he captures the mysteries of childhood through rich, vibrant imagery.
here are some of the 2017 winners from our catalog! take a look at the 2017 winners page for the full list. don’t forget to contact the southfield library to place items on hold if we don’t have a copy available right away! together, a boy and his parents drive to the city of havana, cuba, in their old family car. along the way, they experience the sights and sounds of the streets--neighbors talking, musicians performing, and beautiful, colorful cars putt-putting and bumpety-bumping along. in the end, though, it's their old car, cara cara, that the boy loves best. when sunflower, a young city girl, moves to the countryside, she grows to love the reed marsh lands - the endlessly flowing river, the friendly buffalo with their strong backs and shiny, round heads, the sky that stretches on and on in its vastness. however, the days are long, and the little girl is lonely. then she meets bronze, who, unable to speak, is ostracized by the other village boys. soon the pair are inseparable, and when bronze's family agree to take sunflower in, it seems that fate has brought him the sister he has always longed for. but life in damaidi is hard, and bronze's family can barely afford to feed themselves. can the little city girl stay here, in this place where she has finally found happiness? a classic, heartwarming tale set to the backdrop of the chinese cultural revolution. while gathering firewood, yasuhiro comes upon an injured crane hidden in the snow. he rescues and comforts the bird, then watches it fly away. the next night, a mysterious young girl arrives at yasuhiro's home seeking shelter from the cold. the boy and his father welcome the girl, named hiroko, to stay with them. but when hiroko notices that yasuhiro's father is struggling to earn money, she offers to weave silk for him to sell. after the fabric fetches a good price, the boy's father becomes impatient for more silk, and his greed has a life-changing effect on them all. lyrical storytelling deftly interwoven with original haiku create a magical adaptation of popular japanese folktales--an inspirational story of friendship and the power of kindness to transform lives. freedom. mariah has barely dared to dream of it her entire life. when general sherman’s march through georgia during the civil war passes the plantation where she is enslaved, her life changes instantly. joining the march for protection, mariah heads into the unknown, wondering if she can ever feel safe, if she will ever be able to put the brutalities of slavery behind her. on the march mariah meets a young man named caleb, and a new dream takes root—one of a future with a home of her own and a true love by her side. but hope often comes at a cost. as the treacherous march continues toward the churning waters of ebenezer creek, mariah sees that the harsh realities of her and her peoples’ lives will always haunt them. acclaimed poet bao phi delivers a powerful, honest glimpse into a relationship between father and son and between cultures, old and new. a different pond is an unforgettable story about a simple event--a long-ago fishing trip. as a young boy, bao phi awoke early, hours before his father's long workday began, to fish on the shores of a small pond in minneapolis. unlike many other anglers, bao and his father fished for food, not recreation. a successful catch meant a fed family. between hope-filled casts, bao's father told him about a different pond in their homeland of vietnam. the new york times has said that bao phi's poetry "rhymes with the truth." together with graphic novelist thi bui's striking, evocative art, phi's expertly crafted prose reflects an immigrant family making its way in a new home while honoring its bonds to the past. for arturo, summetime in miami means playing basketball until dark, sipping mango smoothies, and keeping cool under banyan trees. and maybe a few shifts as junior lunchtime dishwasher at abuela's restaurant. maybe. but this summer also includes carmen, a cute poetry enthusiast who moves into arturo's apartment complex and turns his stomach into a deep fryer. he almost doesn't notice the smarmy land developer who rolls into town and threatens to change it. arturo refuses to let his family and community go down without a fight, and as he schemes with carmen, arturo discovers the power of poetry and protest through untold family stories and the work of jose marti. the story of one of america’s most revered figures is brought to life by the text of award-winning author walter dean myers and the sweeping, lush illustrations of artist floyd cooper. this sweet, rhyming counting book introduces young readers to numbers one through fifteen as grandma's family and friends fill her tiny house on brown street. neighbors, aunts, uncles, nieces, nephews, and grandkids crowd into the house and pile it high with treats for a family feast. where there's a will there's a way when families grow and come together. in one day, four lives weave together in unexpected ways. virgil salinas is shy and kindhearted and feels out of place in his loud and boisterous family. valencia somerset, who is deaf, is smart, brave, and secretly lonely, and loves everything about nature. kaori tanaka is a self-proclaimed psychic, whose little sister gen is always following her around. and chet bullens wishes the weird kids would just act normal so that he can concentrate on basketball. they aren’t friends -- at least not until chet pulls a prank that traps virgil and his pet guinea pig at the bottom of a well. this disaster leads kaori, gen, and valencia on an epic quest to find the missing virgil. through luck, smarts, bravery, and a little help from the universe, a rescue is performed, a bully is put in his place, and friendship blooms. fifteen-year-old will has shoved a gun in the back waistband of his jeans. see, his brother shawn was just murdered. and will knows the rules. no crying. no snitching. revenge. that’s where will’s now heading, with that gun shoved in the back waistband of his jeans, the gun that was his brother’s gun. he gets on the elevator, seventh floor, stoked. he knows who he’s after. or does he? as the elevator stops on the sixth floor, on comes buck. buck, will finds out, is who gave shawn the gun before will took the gun. buck tells will to check that the gun is even loaded. and that’s when will sees that one bullet is missing. and the only one who could have fired shawn’s gun was shawn. huh. will didn’t know that shawn had ever actually used his gun. bigger huh. buck is dead. but buck’s in the elevator? just as will’s trying to think this through, the door to the next floor opens. a teenage girl gets on, waves away the smoke from dead buck’s cigarette. will doesn’t know her, but she knew him. knew. when they were eight. and stray bullets had cut through the playground, and will had tried to cover her, but she was hit anyway, and so what she wants to know, on that fifth floor elevator stop, is, what if will, will with the gun shoved in the back waistband of his jeans, misses.. miriam makeba, a grammy award–winning south african singer, rose to fame in the hearts of her people at the pinnacle of apartheid―a brutal system of segregation similar to american jim crow laws. mama africa, as they called her, raised her voice to help combat these injustices at jazz clubs in johannesburg; in exile, at a rally beside dr. martin luther king, jr.; and before the united nations. "in the tradition of delicious, wideness & wonder, and everybody paints!, this is susan goldman rubin's extensively researched and very accessible biography of civic activist maya lin, most famous for her design of the vietnam veterans memorial. the vietnam veterans memorial in washington, d.c., is one of the most famous pieces of civic architecture in the world. but most people are not as familiar with the reserved college student who entered and won the design competition to build it. this accessible biography tells the story of maya lin, from her struggle to stick with her vision of the memorial to the wide variety of works she has created since then. illustrated extensively with photos and drawings, the carefully researched text crosses multiple interests--american history, civic activism, art history, and cultural diversity--and offers a timely celebration of the memorial's 35th anniversary, as well as contributing to the current, important discussion of the role of women and minorities in american society". over the centuries, untold numbers of black men and women in america have achieved great things against the odds. pathfinders is a collective biography of sixteen diverse american men and women of african descent who made their mark on american history in the 18th to 20th centuries. people who dared to dream, take risks, and create goals not only for themselves, but for others and the betterment of their society, too. award-winning author tonya bolden offers an insightful look at these figures, from venture smith, who bought his freedom; to sadie alexander, who contributed to the civil rights movement in the united states; to katherine johnson, who helped the united states land on the moon. jade believes she must get out of her neighborhood if she’s ever going to succeed. her mother says she has to take every opportunity. she has. she accepted a scholarship to a mostly-white private school and even saturday morning test prep opportunities. but some opportunities feel more demeaning than helpful. like an invitation to join women to women, a mentor-ship program for “at-risk” girls. except really, it’s for black girls. from “bad” neighborhoods. in luminous paintings and arresting poems, two of children's literature's top african-american scholars track arturo schomburg's quest to correct history. the adults in casey's life embrace his interests, but jessie isn't so sure. boys aren't supposed to wear sparkly, shimmery, glittery things. then, when older boys at the library tease casey for wearing girl things, jessie realizes that casey has the right to be himself and wear whatever he wants. why can't both she and casey love all things shimmery, glittery, and sparkly? here is a sweet, heartwarming story about acceptance, respect, and the freedom to be yourself in a world where any gender expression should be celebrated. sparkly things are for everyone to enjoy! a boy tries to steer a safe path through the projects in harlem in the wake of his brother's death. the white rose is guarded closely by the gardener, who once caught a cold walking barefoot trying to find his shoes, which had been hidden by a cat, which was a gift from his younger brother, who was married to dalva, who had inherited the cat from her uncle, who died of a broken heart awaiting a love letter that never arrived... eventually, we see how one tiny action can have marvelous consequences, and the story turns like a ferris wheel. with a playful lightness of touch, mello explores serious questions about the importance of kindness and the dangers of greed. mello's illustrations will inspire his young readers, providing them with familiar and approachable images while encouraging imagination to fill in the narrative gaps, as he captures the mysteries of childhood through rich, vibrant imagery.
FoxyBlueEyes AriadnaDream jasmin. WhiteBlond. Karla10. yoursquirterxx. BOYSHOTXXX2LanikaBeatySandraLewisClaireAngel .a0SupremeStudSoIrresistiblesexygrandmaxxcumshow80 .OliviaSinnbeautybigtransVanessaReySweetAngelWaitU .Urslaves4u2cumxxTeddyBarrcumshow80KatrinaJade .beautybigtranssexy4uhotjulia4usexy4uhotjulia4usexygrandmaxx .LewisColonKinsleyMayoAnnaJamilleSoIrresistible .SweetAngelWaitUAmberStillerUrslaves4u2cumxxVivalynn .IraAndKayleeVivalynnMarakuyaaAssAnne .BIGsweetBANANAalexlovefreeLanikaBeatyangelbliss .SweetBellaForUKinsleyMayoMarakuyaaClaireAngel .ClaireAngelSweetBellaForUbeautybigtransInessaPlusHellen . LanikaBeatyTeddyBarrMiiskaMiloslavaQueen .MinaLeeGraceAndBeautyNoradcumshow80 .GraceAndBeautyMarakuyaabesty123MiriamWhite .MinaLeeClaireAngelLewisColonJessycaDD .TyaMartinezClaireAngelOldenDominaSisy .TeddyBarrxxxSvetlanaFIREClairelaireMiloslavaQueen .LibenaMeevickyfamousSweetBellaForUHarveyShaw .OliviaSinnMiriamWhiteKinsleyMayovickyfamous .NinfetoMichaelMMCxxxSvetlanaFIREashleymadyson .SexyJuneMichaelMMCverygenlegirlVanessaRey .DominaSisyAssAnneLibenaMeeClairelaire .
foxyblueeyes ariadnadream jasmin. whiteblond. karla10. yoursquirterxx. boyshotxxx2lanikabeatysandralewisclaireangel .a0supremestudsoirresistiblesexygrandmaxxcumshow80 .oliviasinnbeautybigtransvanessareysweetangelwaitu .urslaves4u2cumxxteddybarrcumshow80katrinajade .beautybigtranssexy4uhotjulia4usexy4uhotjulia4usexygrandmaxx .lewiscolonkinsleymayoannajamillesoirresistible .sweetangelwaituamberstillerurslaves4u2cumxxvivalynn .iraandkayleevivalynnmarakuyaaassanne .bigsweetbananaalexlovefreelanikabeatyangelbliss .sweetbellaforukinsleymayomarakuyaaclaireangel .claireangelsweetbellaforubeautybigtransinessaplushellen . lanikabeatyteddybarrmiiskamiloslavaqueen .minaleegraceandbeautynoradcumshow80 .graceandbeautymarakuyaabesty123miriamwhite .minaleeclaireangellewiscolonjessycadd .tyamartinezclaireangeloldendominasisy .teddybarrxxxsvetlanafireclairelairemiloslavaqueen .libenameevickyfamoussweetbellaforuharveyshaw .oliviasinnmiriamwhitekinsleymayovickyfamous .ninfetomichaelmmcxxxsvetlanafireashleymadyson .sexyjunemichaelmmcverygenlegirlvanessarey .dominasisyassannelibenameeclairelaire .
Pricebd.net is ensuring all the visitors about their privacy and at the same time we are committed to provide our viewers all upcoming information regarding home and kitchen appliance of various local and international brand. You can browse Pricebd.net without using any personal information. Why we asked personal information? We only asked visitors personal information, if they are interested to share their valuable opinion regarding on any product that are listed in our site. We only asked visitors name and E-mail ID. But we never disclose any information to any others firm or any third party. Information that we collect from our visitors is only used to know about visitor’s choice, statistical purpose and to get potential advertisers. We keeps own E-mail list to provide current news and information related to any product to their visitors. You may also receive advertising cookies from our advertisers. This is a standard practice in the Internet industry. We have no control over these cookies. If you do not prefer to receive cookies during the time of browsing our website. You can fix your browser to inform you before receiving cookies and ignore the cookies, when your browser alerts you to its presence. You can also avoid all cookies by turning them off in your browser.
pricebd.net is ensuring all the visitors about their privacy and at the same time we are committed to provide our viewers all upcoming information regarding home and kitchen appliance of various local and international brand. you can browse pricebd.net without using any personal information. why we asked personal information? we only asked visitors personal information, if they are interested to share their valuable opinion regarding on any product that are listed in our site. we only asked visitors name and e-mail id. but we never disclose any information to any others firm or any third party. information that we collect from our visitors is only used to know about visitor’s choice, statistical purpose and to get potential advertisers. we keeps own e-mail list to provide current news and information related to any product to their visitors. you may also receive advertising cookies from our advertisers. this is a standard practice in the internet industry. we have no control over these cookies. if you do not prefer to receive cookies during the time of browsing our website. you can fix your browser to inform you before receiving cookies and ignore the cookies, when your browser alerts you to its presence. you can also avoid all cookies by turning them off in your browser.
Magrath's residence is an eclectic construction evincing the strong influences of the Georgian Revival and Neoclassical architectural styles. Prominent features of the Magrath Mansion include the symmetrical front facade, two-storey colonnade supported by robust classical columns, hipped roof with gable dormers and wrap-around porch and balcony. Real estate dealer W.J. Magrath built this mansion in 1912 to reflect his success in Edmonton's pre-First World War building boom. It is one of the finest architectural achievements in Alberta, with fine materials and craftsmanship used in the interior and exterior of the home. Oak paneling, a grand winding staircase, linen wall coverings, sculptured ceilings and built-in leaded-glass cabinets on the main floor are among the many interesting architectural features. W.J. Magrath resided here until his death in 1920. Magrath, a successful businessman actively involved in real estate, was involved in the development of the Highland subdivision in Edmonton. The house remained in the Magrath family until the early thirties. Few homes built during Edmonton's development excel the Magrath Mansion in architectural design, craftsmanship and materials. For more information on booking Magrath Mansion as an event venue, please call 780-619-2223. Looking Northwest. Photo by AB Culture &amp; Community Spirit, 2000. Looking Northeast, 1916. Glenbow Archives NC-6-2143.
magrath's residence is an eclectic construction evincing the strong influences of the georgian revival and neoclassical architectural styles. prominent features of the magrath mansion include the symmetrical front facade, two-storey colonnade supported by robust classical columns, hipped roof with gable dormers and wrap-around porch and balcony. real estate dealer w.j. magrath built this mansion in 1912 to reflect his success in edmonton's pre-first world war building boom. it is one of the finest architectural achievements in alberta, with fine materials and craftsmanship used in the interior and exterior of the home. oak paneling, a grand winding staircase, linen wall coverings, sculptured ceilings and built-in leaded-glass cabinets on the main floor are among the many interesting architectural features. w.j. magrath resided here until his death in 1920. magrath, a successful businessman actively involved in real estate, was involved in the development of the highland subdivision in edmonton. the house remained in the magrath family until the early thirties. few homes built during edmonton's development excel the magrath mansion in architectural design, craftsmanship and materials. for more information on booking magrath mansion as an event venue, please call 780-619-2223. looking northwest. photo by ab culture &amp; community spirit, 2000. looking northeast, 1916. glenbow archives nc-6-2143.
Chicago: “Greater Boston; Spence Leaving DSS / Fallen Swampscott Soldiers,” 05/23/2007, WGBH Media Library & Archives, accessed April 20, 2019, http://openvault.wgbh.org/catalog/V_C3486415AEEB404D95538CB9B9E9412E. MLA: “Greater Boston; Spence Leaving DSS / Fallen Swampscott Soldiers.” 05/23/2007. WGBH Media Library & Archives. Web. April 20, 2019. <http://openvault.wgbh.org/catalog/V_C3486415AEEB404D95538CB9B9E9412E>.
chicago: “greater boston; spence leaving dss / fallen swampscott soldiers,” 05/23/2007, wgbh media library & archives, accessed april 20, 2019, http://openvault.wgbh.org/catalog/v_c3486415aeeb404d95538cb9b9e9412e. mla: “greater boston; spence leaving dss / fallen swampscott soldiers.” 05/23/2007. wgbh media library & archives. web. april 20, 2019. <http://openvault.wgbh.org/catalog/v_c3486415aeeb404d95538cb9b9e9412e>.
The list of Most Popular female names in USA in 1983 with their respective percentage. Choose girl name from popular names trending in America in 1983. Also see our 1983 list of top boy names.
the list of most popular female names in usa in 1983 with their respective percentage. choose girl name from popular names trending in america in 1983. also see our 1983 list of top boy names.
Jenkins and Wynne has been family owned and operated since 1953. Our Community has voted us 'The Best Place To Buy A Vehicle in Clarksville, TN' for 14 years in a row in 2014! You can buy a vehicle with peace of mind at Jenkins and Wynne. If for some reason you don't like the vehicle you purchased, bring it back within 48 hours and less than 200 miles. We will help you find a vehicle that fits you better! Are you a social media lover? So are we!
jenkins and wynne has been family owned and operated since 1953. our community has voted us 'the best place to buy a vehicle in clarksville, tn' for 14 years in a row in 2014! you can buy a vehicle with peace of mind at jenkins and wynne. if for some reason you don't like the vehicle you purchased, bring it back within 48 hours and less than 200 miles. we will help you find a vehicle that fits you better! are you a social media lover? so are we!
Let's celebrate the beginning of a new moon by working towards our goals and setting intentions. Why is it important to set intentions? To achieve our goals, we must first become clear on what we want, how to get there & what we need to let go of. Cycling your intentions around the New and Full Moons can create a powerful energetic experience. The New Moon represents a fresh start or a new beginning. Let's harness this energy and work through this together with a guided step-by-step process on how to turn your dreams into a reality. Here you will learn the ultimate intention setting process: manifestation 101, how to tap away your limiting beliefs and how to set intentions that turn into real, achievable goals. Walk away feeling light & inspired to level-up your life. Sometimes we get to a point in our life when “enough is enough” and we’re ready to make a change. We don’t know how, or what to do - but we know it’s time. This time is important, your onto something - something that your body & soul need. Don’t ignore it, move towards it. Lets move towards that change together. Together we can create long lasting results. Results that don’t only create weight loss, but a lifestyle change coupled with an understanding of your WHY. Why you’re making this change. Why you’re eating the right foods for your body. Why those fad diets don’t work and why you’re going to stick with this change even after this program is over. Lets kick the fad-diet mentality to the curb and get back to the basics. Start understanding our food again so that you can make sense of what you’re eating! Join me on this 30-day journey to the best version of ourselves. We’ll make big strides towards our weight loss goals and create a healthier version of ourselves. Please note that this is a non-judgmental, inclusive program. Bringing you back to an awareness and connection with yourself and your body. Re-learning what makes you feel good and what doesn’t. Creating a workout routine that is achievable, sustainable AND fun! A custom plan. We’re meeting you where you’re at, where you’re at is the perfect place to start your health journey. The goal of feeling better than ever! For signing up for this program, you’ll receive a FREE 3-Pack of Salt Therapy Passes! DUE TO THE NATURE OF THIS PROGRAM, SPACES ARE VERY LIMITED! If you are interested in joining, please fill out this application and our team will get back to you soonest! Feeling Fluffy, Puffy & Gross? Kick start your metabolism, lose the bloat & reduce inflammation just in time for spring break with this 14-day anti-inflammatory program! Why participate in our anti-inflammatory program? Chronic inflammation is linked to weight gain, food intolerances and a host of other health concerns. Hormone imbalances also lead to chronic inflammation and vice versa. This is a quickstart program to make you can feel better, look better, be better just in time for Spring Break! Let’s get ready for spring together! Day 1: In just a few hours get a comprehensive nutrition & inflammation assessment. Day 2-13: Take home a 14-day meal plan & supporting supplements. Our team of experts just an email away for any questions or concerns during the program. Day 14: A post-cleanse debrief, re-assessment & celebration of your success! Click here for Program Admission. If you are a woman struggling to lose weight or overcome a ‘slow metabolism, there are some things you really need to know. It is NOT about eating less and exercising more…. there’s something else going on! Join our Nutritionist, Trish Krause (CNP, RNCP) on Thursday, January 17th at 6pm for a FREE health talk that will help you bust through the barriers in 2019 for good. The #1 secret why women (especially of a certain age) don’t lose weight - and what you can do about it. The well-meaning (or not) conspiracy by global diet experts that keep us fat and stuck. How to super-charge your success by harnessing The BIG 3 Metabolic S’s. Why things will never change for you – until you take this one important step. Don’t miss out – understanding this information has been a game-changer for so many women. And can be for you too. During our three day workshop, we’ll assist you in setting the proper intentions while guiding you toward an introspective, awareness expanding opportunity. The result is a deep connection between us and yourself and of course YOU with the deeper part of YOU. Our health, lifestyle and consciousness engineers have a wealth of experience and expertise in the introspection and healing arts, making our modern techniques for optimized healing, growth and creating the life you love, unmatched anywhere in the world. We greet you with a heart to heart connection, and from our place of heart centred, heart first intention to assist you in your journey of Self discovery. Via proven meditative, breathing, thinking, and training techniques, backed by sound scientific evidence from around the world, we guide you on an inward journey of epic proportions, as only we are able. Join us for a transformative experience unlike any other. Once you’ve awakened to the beauty within and what life truly has to offer, it will be impossible for you to go back to the way things were. JOIN HOLISTIC RAIN, SIMPLYWELL & FRIENDS FOR AN EVENING OF LIVE MUSIC, SHOPPING, WELLNESS, ART, VEGAN WINE & MORE. Drop into SimplyWell's gorgeous new location at 267 Ontario Street, directly across the street from Moksha Yoga and help raise money for Loving Spoonful ~ a local nonprofit that works hard to provide access to healthy food in an empowering, inclusive and environmentally sustainable manner. Karlo Estates will be pouring beautiful vegan wines, and you can order bottles for the holidays! Enjoy a live music showcase featuring soulful local musicians! We're excited to share with you SimplyWell's NEW Integrative Health Centre, you'll be so pleased to learn all about what will now be available to you in downtown Kingston! We love creating space to bring our community together to honour the holidays, celebrate each other, and support local causes and artists that are close to our hearts. Everyone is welcome, it's free to join us, we look forward to seeing you there! Daniella Good Photography is setting up shop in our studio space to bring to you Holiday Mini Photo Sessions! Book in for 20 minute appointments and receive 4 images. You pick your props! You've asked & we're listening! Since the transition of SimplyWell out of the smoothie game - so many of you have requested a smoothie night to learn how to make the delicious & nutritous SW smoothies! We're excited to announce the opportunity to let us teach you how-to make them at home! What: Smoothie making + chatting about ways to up your smoothie game with lots of nutrients and the benefits of supplements! Bring all your questions and appetite! Come join us in a refreshing evening of learning, sharing and introducing ourselves in the art of KOMBUCHA making! This delightful workshop will go over the health benefits of probiotics and probiotic-rich beverages. We will discuss the best ways to incorporate it into your diet to enhance the immune system and digestive health (and for deliciousness!). We will demonstrate easy techniques and learn how to brew your own booch at home. We will also learn how to make a second fermentation to flavour it naturally! You will leave with a Kombucha Starter Kit to take home, a step-by-step instruction handout (including nourishing and delicious mocktail recipes!), and ongoing support. Plus, as an extra-bonus, we will taste FREE samples of home brewed booch in various natural flavours! Where: Simply Well – 34 Princess Street. Kingston, ON. Wondering what Ayurveda is? What can you do with it? And how can you apply it in your live? LOOK NO FURTHER! In this introductory workshop we will explore together one of the world’s most sophisticated and powerful mind-body health systems also known as the science of life. We are going to learn and understand the different mind-body types and the specific needs that derive from them. We will find out your unique body constitution so that you can take home an instructional handout that will have dietary and lifestyle recommendations to enhance your life to its best! PLUS! We will taste and learn how to make a medicinal green detox smoothie and you will take home Ayurvedic recipes to cook and enjoy! Where: Simply Well - 34 Princess St. Kingston, ON. We're hosting a day retreat for teenagers aged 13-18 on Sunday, July 8th in Kingston, Ontario. We've brought together a powerful group of female trailblazers to lead the conversation, with content based on the foundation of overall wellness of mind, body, and spirit. We are passionate about connecting with our youth with the message of mindfulness, compassion, kindness, and living a holistic lifestyle filled with happiness and joy. You will leave this retreat feeling inspired, empowered, rejuvenated, and a little more clear on what you want to create in your beautiful life. Author, Speaker, Mentor, Certified Meditation Instructor, Certified Fitness Instructor, Certified Coach, Black Belt in Kung Fu Kickboxing, facilitator for "Design Thinking", Chartered Professional Accountant, and Senior Executive at her company in Toronto. Trish was also awarded the Queen’s Diamond Jubilee medal for her long-term service with Big Brothers Big Sisters of Canada, and has served as the organizations’ Chair of the Board. Kelli is an entrepreneur, Reiki Practitioner, and Founder of Holistic Rain, a lifestyle brand focused on creating tools and providing services and events that heal you holistically, from the inside out. Kelli's work brings communities of like-minds together to inspire, empower, and lift each other up. She’s also a wife and mother, Partner at Aurora Water Health, is a Crystal Consultant, and is studying to become a Registered Holistic Nutritionist. Dr. Jillian Murphy is a registered, licensed Doctor of Naturopathic Medicine. She works with diverse, smart, health-conscious, women who are DONE WITH DIETING, looking to get out of their heads (that are, quite frankly driving them CRAZY!) and re-connect with their body. Jillian has dedicated the past 8 years to studying intuitive eating and body image in women and, in conjunction with her general education in nutrition and holistic health, she has developed The Food Freedom/Body Love Method: a program that combines cutting edge eating psychology, in-the-know insight & guidance around diet culture, health, weight, and body acceptance to teach women WHY they stay stuck in negative patterns around food and body....and to break free, for good! Claire's work is dedicated to the hashtag #SpreadYourAwesome. She believes that life should be about dedicating moments of your day to creativity and curiosity. Claire has a background of teaching, music, sports, fashion, design, travel, photography, art directing and creative design. A successful young entrepreneur, she has dedicated the last ten years to helping women reach their full potential through the arts and entrepreneurship. Her goal is to help thousands of women around the globe become strong women and leaders in their communities. Jehna is a certified nutritionist and the owner of SimplyWell a vegan cafe/juice bar/holistic centre and SimplyWell Living, a vegan blog. Her goal is to share information on how to safely and easily transition into a plant based diet. Through working with clients and customers at SimplyWell, she has seen many people who aspire to be plant based, become very unhealthy throughout the process. Her goal is to educate that removing animal products out of your diet is not enough for you to become healthy. Herbivores and carnivores alike need to be mindful of eating whole foods, not focusing so much on vegan vs. meat based. Think of the bigger picture, not your individual ingredients. Space is limited and will sell out quickly. Tickets are non-refundable but are transferrable. This is an incredible event inspiring each participant to connect with each other, creating a community of teens who are experiencing many of the same challenges. SimplyWell and Holistic Rain are hosting another Summer Solstice Celebration on Thursday, June 21st in Springer Market Square with all proceeds going to local charity, Peace In Minds! The event was a huge success last year, and so was the Fall Equinox Charity Party last September. We had hundreds of yoga mats spread across the Square and the energy was incredible. We're creating an even bigger and better event this year, and giving many new local entertainers and artists a chance to participate. We’re excited to be giving back to the community while bringing people together to share in the beautiful Summer Solstice energy. Solstice is a time of celebration, intensity, renewal, great potential, and honouring the light in ourselves and each other and our deep connection with the Sun and Mother Earth. We are all connected: people, the planet, and the sun. If we align ourselves with the power in others and in the natural forces around us, what we are unable to do on our own can be made to happen through the powerful energy of collective consciousness. That’s what this evening is all about. lululemon Kingston will be there with some VERY cool offerings and are one of our sponsors! Stay tuned as we add more incredible pieces to this beautiful event! All of the participants – performers, practitioners, and vendors – are donating proceeds to this cause. This is an incredible group who have joined forces to make a difference and support our local community! Peace In Minds' mission is to increase the safety and wellbeing of persons living with mental illness by increasing mental health education and treatment capacity in resource poor communities. Peace In Minds (PIM) is an organization built on the conviction that increasing mental health education, training and treatment capacity will improve global health. PIM provides specialized mental health education and program development in resource poor communities and populations. Get your tickets in advance, gift a ticket to your loved ones, share this event with your friends…let’s join forces and make a significant impact on the well-being of our local Kingston community! Mark your calendars, see you there! Want to learn how to fend off those Full Moon jitters? US TOO! Join Holistic Rain and SimplyWell for another magical evening in the Sanctuary's beautiful space. ~ A guided crystal meditation - and you will go home with the crystal you work with throughout this session! ~ how do you want to FEEL in your life? ~ what do you want to STOP doing or feeling? Then we'll write our intentions - what we want to release - and burn it! You will leave feeling empowered, rejuvenated, and ready to invite new experiences into your reality. Looking forward to seeing you there and sharing the beautiful energy this event inspires. SimplyWell & Holistic Rain have come together to bring to you a series of Full Moon Parties! December 1st for a fun filled evening of birthday celebrations! We want to thank you all SO much for being such wonderful customers and making SimplyWell feel like a family. We couldn't do it without each & everyone of you! BUY 3 KAIA NATURALS HOT BATHS, GET ONE FREE! ENJOY 20% OFF SMOOTHIES ALL DAY LONG! SimplyWell and Holistic Rain are hosting an Autumn Equinox Celebration on Friday, September 22nd in Market Square with all proceeds going to charity! We’re excited to be giving back to the community while bringing people together to share in the beautiful Equinox energy. As we consciously link our awareness to nature's cycles, our understanding of our own cycles begin to deepen. The Autumn Equinox is a meaningful time of year to honour the harvest. Whether that be a "real" harvest of the things planted in your garden or the harvest of efforts and intentions for your life path set earlier in the year. Spiritually speaking, fall represents the Harvest time of year, a time to acknowledge abundance as our natural state of being. Our lives go through cycles of growth, harvest, death, and rebirth just as we see in nature. All of the participants – performers, practitioners, and vendors – are donating proceeds to the cause. This is an incredible group who have joined forces to make a difference and support our local community! Mark you calendars, this is going to be magic. Performers and other activities will be announced soon. SimplyWell and Holistic Rain are hosting a Summer Solstice Celebration on Wednesday, June 21st in Market Square with all proceeds going to Loving Spoonful! All of the participants – performers, practitioners, and vendors – are donating proceeds to Loving Spoonful. This is an incredible group who have joined forces to make a difference and support our local community! Loving Spoonful works to achieve a healthy food-secure community by facilitating fresh food access, skill development and community engagement in a collaborative, empowering and environmentally sustainable manner. Join Amanda Cronk as she hosts an intro to doTerra workshop!
let's celebrate the beginning of a new moon by working towards our goals and setting intentions. why is it important to set intentions? to achieve our goals, we must first become clear on what we want, how to get there & what we need to let go of. cycling your intentions around the new and full moons can create a powerful energetic experience. the new moon represents a fresh start or a new beginning. let's harness this energy and work through this together with a guided step-by-step process on how to turn your dreams into a reality. here you will learn the ultimate intention setting process: manifestation 101, how to tap away your limiting beliefs and how to set intentions that turn into real, achievable goals. walk away feeling light & inspired to level-up your life. sometimes we get to a point in our life when “enough is enough” and we’re ready to make a change. we don’t know how, or what to do - but we know it’s time. this time is important, your onto something - something that your body & soul need. don’t ignore it, move towards it. lets move towards that change together. together we can create long lasting results. results that don’t only create weight loss, but a lifestyle change coupled with an understanding of your why. why you’re making this change. why you’re eating the right foods for your body. why those fad diets don’t work and why you’re going to stick with this change even after this program is over. lets kick the fad-diet mentality to the curb and get back to the basics. start understanding our food again so that you can make sense of what you’re eating! join me on this 30-day journey to the best version of ourselves. we’ll make big strides towards our weight loss goals and create a healthier version of ourselves. please note that this is a non-judgmental, inclusive program. bringing you back to an awareness and connection with yourself and your body. re-learning what makes you feel good and what doesn’t. creating a workout routine that is achievable, sustainable and fun! a custom plan. we’re meeting you where you’re at, where you’re at is the perfect place to start your health journey. the goal of feeling better than ever! for signing up for this program, you’ll receive a free 3-pack of salt therapy passes! due to the nature of this program, spaces are very limited! if you are interested in joining, please fill out this application and our team will get back to you soonest! feeling fluffy, puffy & gross? kick start your metabolism, lose the bloat & reduce inflammation just in time for spring break with this 14-day anti-inflammatory program! why participate in our anti-inflammatory program? chronic inflammation is linked to weight gain, food intolerances and a host of other health concerns. hormone imbalances also lead to chronic inflammation and vice versa. this is a quickstart program to make you can feel better, look better, be better just in time for spring break! let’s get ready for spring together! day 1: in just a few hours get a comprehensive nutrition & inflammation assessment. day 2-13: take home a 14-day meal plan & supporting supplements. our team of experts just an email away for any questions or concerns during the program. day 14: a post-cleanse debrief, re-assessment & celebration of your success! click here for program admission. if you are a woman struggling to lose weight or overcome a ‘slow metabolism, there are some things you really need to know. it is not about eating less and exercising more…. there’s something else going on! join our nutritionist, trish krause (cnp, rncp) on thursday, january 17th at 6pm for a free health talk that will help you bust through the barriers in 2019 for good. the #1 secret why women (especially of a certain age) don’t lose weight - and what you can do about it. the well-meaning (or not) conspiracy by global diet experts that keep us fat and stuck. how to super-charge your success by harnessing the big 3 metabolic s’s. why things will never change for you – until you take this one important step. don’t miss out – understanding this information has been a game-changer for so many women. and can be for you too. during our three day workshop, we’ll assist you in setting the proper intentions while guiding you toward an introspective, awareness expanding opportunity. the result is a deep connection between us and yourself and of course you with the deeper part of you. our health, lifestyle and consciousness engineers have a wealth of experience and expertise in the introspection and healing arts, making our modern techniques for optimized healing, growth and creating the life you love, unmatched anywhere in the world. we greet you with a heart to heart connection, and from our place of heart centred, heart first intention to assist you in your journey of self discovery. via proven meditative, breathing, thinking, and training techniques, backed by sound scientific evidence from around the world, we guide you on an inward journey of epic proportions, as only we are able. join us for a transformative experience unlike any other. once you’ve awakened to the beauty within and what life truly has to offer, it will be impossible for you to go back to the way things were. join holistic rain, simplywell & friends for an evening of live music, shopping, wellness, art, vegan wine & more. drop into simplywell's gorgeous new location at 267 ontario street, directly across the street from moksha yoga and help raise money for loving spoonful ~ a local nonprofit that works hard to provide access to healthy food in an empowering, inclusive and environmentally sustainable manner. karlo estates will be pouring beautiful vegan wines, and you can order bottles for the holidays! enjoy a live music showcase featuring soulful local musicians! we're excited to share with you simplywell's new integrative health centre, you'll be so pleased to learn all about what will now be available to you in downtown kingston! we love creating space to bring our community together to honour the holidays, celebrate each other, and support local causes and artists that are close to our hearts. everyone is welcome, it's free to join us, we look forward to seeing you there! daniella good photography is setting up shop in our studio space to bring to you holiday mini photo sessions! book in for 20 minute appointments and receive 4 images. you pick your props! you've asked & we're listening! since the transition of simplywell out of the smoothie game - so many of you have requested a smoothie night to learn how to make the delicious & nutritous sw smoothies! we're excited to announce the opportunity to let us teach you how-to make them at home! what: smoothie making + chatting about ways to up your smoothie game with lots of nutrients and the benefits of supplements! bring all your questions and appetite! come join us in a refreshing evening of learning, sharing and introducing ourselves in the art of kombucha making! this delightful workshop will go over the health benefits of probiotics and probiotic-rich beverages. we will discuss the best ways to incorporate it into your diet to enhance the immune system and digestive health (and for deliciousness!). we will demonstrate easy techniques and learn how to brew your own booch at home. we will also learn how to make a second fermentation to flavour it naturally! you will leave with a kombucha starter kit to take home, a step-by-step instruction handout (including nourishing and delicious mocktail recipes!), and ongoing support. plus, as an extra-bonus, we will taste free samples of home brewed booch in various natural flavours! where: simply well – 34 princess street. kingston, on. wondering what ayurveda is? what can you do with it? and how can you apply it in your live? look no further! in this introductory workshop we will explore together one of the world’s most sophisticated and powerful mind-body health systems also known as the science of life. we are going to learn and understand the different mind-body types and the specific needs that derive from them. we will find out your unique body constitution so that you can take home an instructional handout that will have dietary and lifestyle recommendations to enhance your life to its best! plus! we will taste and learn how to make a medicinal green detox smoothie and you will take home ayurvedic recipes to cook and enjoy! where: simply well - 34 princess st. kingston, on. we're hosting a day retreat for teenagers aged 13-18 on sunday, july 8th in kingston, ontario. we've brought together a powerful group of female trailblazers to lead the conversation, with content based on the foundation of overall wellness of mind, body, and spirit. we are passionate about connecting with our youth with the message of mindfulness, compassion, kindness, and living a holistic lifestyle filled with happiness and joy. you will leave this retreat feeling inspired, empowered, rejuvenated, and a little more clear on what you want to create in your beautiful life. author, speaker, mentor, certified meditation instructor, certified fitness instructor, certified coach, black belt in kung fu kickboxing, facilitator for "design thinking", chartered professional accountant, and senior executive at her company in toronto. trish was also awarded the queen’s diamond jubilee medal for her long-term service with big brothers big sisters of canada, and has served as the organizations’ chair of the board. kelli is an entrepreneur, reiki practitioner, and founder of holistic rain, a lifestyle brand focused on creating tools and providing services and events that heal you holistically, from the inside out. kelli's work brings communities of like-minds together to inspire, empower, and lift each other up. she’s also a wife and mother, partner at aurora water health, is a crystal consultant, and is studying to become a registered holistic nutritionist. dr. jillian murphy is a registered, licensed doctor of naturopathic medicine. she works with diverse, smart, health-conscious, women who are done with dieting, looking to get out of their heads (that are, quite frankly driving them crazy!) and re-connect with their body. jillian has dedicated the past 8 years to studying intuitive eating and body image in women and, in conjunction with her general education in nutrition and holistic health, she has developed the food freedom/body love method: a program that combines cutting edge eating psychology, in-the-know insight & guidance around diet culture, health, weight, and body acceptance to teach women why they stay stuck in negative patterns around food and body....and to break free, for good! claire's work is dedicated to the hashtag #spreadyourawesome. she believes that life should be about dedicating moments of your day to creativity and curiosity. claire has a background of teaching, music, sports, fashion, design, travel, photography, art directing and creative design. a successful young entrepreneur, she has dedicated the last ten years to helping women reach their full potential through the arts and entrepreneurship. her goal is to help thousands of women around the globe become strong women and leaders in their communities. jehna is a certified nutritionist and the owner of simplywell a vegan cafe/juice bar/holistic centre and simplywell living, a vegan blog. her goal is to share information on how to safely and easily transition into a plant based diet. through working with clients and customers at simplywell, she has seen many people who aspire to be plant based, become very unhealthy throughout the process. her goal is to educate that removing animal products out of your diet is not enough for you to become healthy. herbivores and carnivores alike need to be mindful of eating whole foods, not focusing so much on vegan vs. meat based. think of the bigger picture, not your individual ingredients. space is limited and will sell out quickly. tickets are non-refundable but are transferrable. this is an incredible event inspiring each participant to connect with each other, creating a community of teens who are experiencing many of the same challenges. simplywell and holistic rain are hosting another summer solstice celebration on thursday, june 21st in springer market square with all proceeds going to local charity, peace in minds! the event was a huge success last year, and so was the fall equinox charity party last september. we had hundreds of yoga mats spread across the square and the energy was incredible. we're creating an even bigger and better event this year, and giving many new local entertainers and artists a chance to participate. we’re excited to be giving back to the community while bringing people together to share in the beautiful summer solstice energy. solstice is a time of celebration, intensity, renewal, great potential, and honouring the light in ourselves and each other and our deep connection with the sun and mother earth. we are all connected: people, the planet, and the sun. if we align ourselves with the power in others and in the natural forces around us, what we are unable to do on our own can be made to happen through the powerful energy of collective consciousness. that’s what this evening is all about. lululemon kingston will be there with some very cool offerings and are one of our sponsors! stay tuned as we add more incredible pieces to this beautiful event! all of the participants – performers, practitioners, and vendors – are donating proceeds to this cause. this is an incredible group who have joined forces to make a difference and support our local community! peace in minds' mission is to increase the safety and wellbeing of persons living with mental illness by increasing mental health education and treatment capacity in resource poor communities. peace in minds (pim) is an organization built on the conviction that increasing mental health education, training and treatment capacity will improve global health. pim provides specialized mental health education and program development in resource poor communities and populations. get your tickets in advance, gift a ticket to your loved ones, share this event with your friends…let’s join forces and make a significant impact on the well-being of our local kingston community! mark your calendars, see you there! want to learn how to fend off those full moon jitters? us too! join holistic rain and simplywell for another magical evening in the sanctuary's beautiful space. ~ a guided crystal meditation - and you will go home with the crystal you work with throughout this session! ~ how do you want to feel in your life? ~ what do you want to stop doing or feeling? then we'll write our intentions - what we want to release - and burn it! you will leave feeling empowered, rejuvenated, and ready to invite new experiences into your reality. looking forward to seeing you there and sharing the beautiful energy this event inspires. simplywell & holistic rain have come together to bring to you a series of full moon parties! december 1st for a fun filled evening of birthday celebrations! we want to thank you all so much for being such wonderful customers and making simplywell feel like a family. we couldn't do it without each & everyone of you! buy 3 kaia naturals hot baths, get one free! enjoy 20% off smoothies all day long! simplywell and holistic rain are hosting an autumn equinox celebration on friday, september 22nd in market square with all proceeds going to charity! we’re excited to be giving back to the community while bringing people together to share in the beautiful equinox energy. as we consciously link our awareness to nature's cycles, our understanding of our own cycles begin to deepen. the autumn equinox is a meaningful time of year to honour the harvest. whether that be a "real" harvest of the things planted in your garden or the harvest of efforts and intentions for your life path set earlier in the year. spiritually speaking, fall represents the harvest time of year, a time to acknowledge abundance as our natural state of being. our lives go through cycles of growth, harvest, death, and rebirth just as we see in nature. all of the participants – performers, practitioners, and vendors – are donating proceeds to the cause. this is an incredible group who have joined forces to make a difference and support our local community! mark you calendars, this is going to be magic. performers and other activities will be announced soon. simplywell and holistic rain are hosting a summer solstice celebration on wednesday, june 21st in market square with all proceeds going to loving spoonful! all of the participants – performers, practitioners, and vendors – are donating proceeds to loving spoonful. this is an incredible group who have joined forces to make a difference and support our local community! loving spoonful works to achieve a healthy food-secure community by facilitating fresh food access, skill development and community engagement in a collaborative, empowering and environmentally sustainable manner. join amanda cronk as she hosts an intro to doterra workshop!
Today designer, Joann is sharing an adorable birthday card she made for her mom. Check it out! Hi! I’m so happy that you have stopped by! As I mentioned in one of my previous post, I recently purchased the CTMH Artbooking Cricut collection and one of the many reasons was the overlay images. I love stencils and modeling paste and thought that it would be fun to be able to create some of my own stencils and size them to whichever size I wanted. I just placed my stencil on my card base and applied the modeling paste right on top. It was so easy and I was really happy with the results and the best thing is that I can reuse my stencil…woohoo! There are so many great images on this cartridge, I’m telling you, it’s a must have. I took some watercolor paper and used my cricut and the Artbooking cartridge to cut the circle swirl image from pg 55, the tag from pg 83, and the happy birthday image from pg 86. I stamped a butterfly image using the CTMH Sweet Moments stamp set on my tag with some white embossing powder. I then used CTMH Inks Lagoon and Cotton Candy, to water-color my images by adding some ink on a clear block and then taking some water and a brush to pick up the color and adding it to my images creating a ombre look. To finish off my card I added a beautiful flair from the Family Themed Flair. These are so nice and could be used to personalize any card or project for your loved one. Hope you enjoyed and thanks again for stopping by and as always don’t forget to check out TCP Etsy shop to pick up some awesome flair. There are tons of great new items in the store! Thanks Joann! I love the texture the modeling paste gives to the card and a great use of flair too! Beautiful Card. I love that you can make your own stencils too. implants and artificial one as they once were–if they look is a least more overweight. A vopice lift as a simple in and pop culture figures.
today designer, joann is sharing an adorable birthday card she made for her mom. check it out! hi! i’m so happy that you have stopped by! as i mentioned in one of my previous post, i recently purchased the ctmh artbooking cricut collection and one of the many reasons was the overlay images. i love stencils and modeling paste and thought that it would be fun to be able to create some of my own stencils and size them to whichever size i wanted. i just placed my stencil on my card base and applied the modeling paste right on top. it was so easy and i was really happy with the results and the best thing is that i can reuse my stencil…woohoo! there are so many great images on this cartridge, i’m telling you, it’s a must have. i took some watercolor paper and used my cricut and the artbooking cartridge to cut the circle swirl image from pg 55, the tag from pg 83, and the happy birthday image from pg 86. i stamped a butterfly image using the ctmh sweet moments stamp set on my tag with some white embossing powder. i then used ctmh inks lagoon and cotton candy, to water-color my images by adding some ink on a clear block and then taking some water and a brush to pick up the color and adding it to my images creating a ombre look. to finish off my card i added a beautiful flair from the family themed flair. these are so nice and could be used to personalize any card or project for your loved one. hope you enjoyed and thanks again for stopping by and as always don’t forget to check out tcp etsy shop to pick up some awesome flair. there are tons of great new items in the store! thanks joann! i love the texture the modeling paste gives to the card and a great use of flair too! beautiful card. i love that you can make your own stencils too. implants and artificial one as they once were–if they look is a least more overweight. a vopice lift as a simple in and pop culture figures.
Despite conflicts and political developments brewing just beyond their borders, Arab business leaders in the Gulf are confident that their current economic boom is sustainable and will help accelerate progressive changes taking place within their countries. It’s not that they are unconcerned with Iran’s aggressive posture, the dangers posed by instability in Iraq or the tension emanating from the continuing Arab-Israeli conflict. Rather, the optimism of Gulf business leaders appears to be based on the confluence of several positive developments occurring within their region. In preparation for a presentation I was invited to make at a McKinsey and Company-sponsored panel at the recent World Economic Forum meeting in Davos, I surveyed Arab business leaders to see how they viewed the Gulf’s current and future prospects. I found broad agreement that the region was in the midst of what some termed a “renaissance,” which most attributed to more than the “oil boom.” My respondents pointed to their region’s maturation after decades of social and economic development. One, for example, termed current advances as the “payoff for past investments in the economic and social infrastructure.” A number of business leaders also pointed to the liberalization that has opened up many of the Gulf’s economies, creating new opportunities that have empowered and energized the private sector, fostering, in many countries, a “new partnership” between government and the business community. As a result of theses changes, my respondents largely agreed that oil revenues were being used more wisely than they were in the 1970s and 1980s. But concerns were expressed as well. Some were troubled that the region remained too dependent on oil and gas and required greater diversification. And there was general consensus that liberalization of the region’s economies, more citizen participation, greater efforts to empower women and more investments in 21st century education were needed if the region’s promise of a renaissance was to become a reality. Given the Gulf’s longstanding and substantial economic ties with the US, it was not surprising that there was broad agreement that the US would continue to wield significant political and economic clout in the region. But some struck a cautionary note. A few businessmen, for example, noted that policies pursued by the Bush administration had a negative impact on attitudes in the region and may, if sustained over the term, affect business decisions in the future. As evidenced by King Abdallah bin Abdul Aziz’s recent successful visit to China, India, and Southeast Asia, many Arab Gulf business leaders are “looking east.” This is not to say that Asia is expected to replace the US as the locus for future Arab investment. But there is broad agreement that China and India, in particular, will, in the near future, compete for their share of Arab investment dollars. By far and away, the single greatest threat to the businessmen I interviewed was the current situation in Iraq and the instability in the region resulting from the US invasion. There is the worry that a destabilized Iraq has empowered and emboldened Iran. One businessman, for example, noted that, for decades, the problem posed by Iraq was that of its regime–a short-term threat. The problem posed by Iran, on the one hand, was that of a long-term strategic threat compounded by the extremist ideology and its regional ambitions. All that being said, most remain quite optimistic, confident that progressive changes will continue to unfold in their countries and that oil revenues will be wisely invested, producing still greater social and political benefits. And they are hopeful that the next US administration will bring a change in policy toward the Arab world, enhancing stability and reducing the threats posed by extremists in their region.
despite conflicts and political developments brewing just beyond their borders, arab business leaders in the gulf are confident that their current economic boom is sustainable and will help accelerate progressive changes taking place within their countries. it’s not that they are unconcerned with iran’s aggressive posture, the dangers posed by instability in iraq or the tension emanating from the continuing arab-israeli conflict. rather, the optimism of gulf business leaders appears to be based on the confluence of several positive developments occurring within their region. in preparation for a presentation i was invited to make at a mckinsey and company-sponsored panel at the recent world economic forum meeting in davos, i surveyed arab business leaders to see how they viewed the gulf’s current and future prospects. i found broad agreement that the region was in the midst of what some termed a “renaissance,” which most attributed to more than the “oil boom.” my respondents pointed to their region’s maturation after decades of social and economic development. one, for example, termed current advances as the “payoff for past investments in the economic and social infrastructure.” a number of business leaders also pointed to the liberalization that has opened up many of the gulf’s economies, creating new opportunities that have empowered and energized the private sector, fostering, in many countries, a “new partnership” between government and the business community. as a result of theses changes, my respondents largely agreed that oil revenues were being used more wisely than they were in the 1970s and 1980s. but concerns were expressed as well. some were troubled that the region remained too dependent on oil and gas and required greater diversification. and there was general consensus that liberalization of the region’s economies, more citizen participation, greater efforts to empower women and more investments in 21st century education were needed if the region’s promise of a renaissance was to become a reality. given the gulf’s longstanding and substantial economic ties with the us, it was not surprising that there was broad agreement that the us would continue to wield significant political and economic clout in the region. but some struck a cautionary note. a few businessmen, for example, noted that policies pursued by the bush administration had a negative impact on attitudes in the region and may, if sustained over the term, affect business decisions in the future. as evidenced by king abdallah bin abdul aziz’s recent successful visit to china, india, and southeast asia, many arab gulf business leaders are “looking east.” this is not to say that asia is expected to replace the us as the locus for future arab investment. but there is broad agreement that china and india, in particular, will, in the near future, compete for their share of arab investment dollars. by far and away, the single greatest threat to the businessmen i interviewed was the current situation in iraq and the instability in the region resulting from the us invasion. there is the worry that a destabilized iraq has empowered and emboldened iran. one businessman, for example, noted that, for decades, the problem posed by iraq was that of its regime–a short-term threat. the problem posed by iran, on the one hand, was that of a long-term strategic threat compounded by the extremist ideology and its regional ambitions. all that being said, most remain quite optimistic, confident that progressive changes will continue to unfold in their countries and that oil revenues will be wisely invested, producing still greater social and political benefits. and they are hopeful that the next us administration will bring a change in policy toward the arab world, enhancing stability and reducing the threats posed by extremists in their region.
Is there a better alternative to Woobies? Is Woobies really the best app in Dashboard category? Will Woobies work good on macOS 10.13.4? Woobies is a bubble Shooter game for your dashboard. Shoot Woobies to create groups of 3 or more with the same color and rescue the Woobies before the big ambos smashes them. Woobies needs a review. Be the first to review this app and get the discussion started! Woobies needs a rating. Be the first to rate this app and get the discussion started!
is there a better alternative to woobies? is woobies really the best app in dashboard category? will woobies work good on macos 10.13.4? woobies is a bubble shooter game for your dashboard. shoot woobies to create groups of 3 or more with the same color and rescue the woobies before the big ambos smashes them. woobies needs a review. be the first to review this app and get the discussion started! woobies needs a rating. be the first to rate this app and get the discussion started!
What Is FUE Hair Transplantation Technique? For those who want to have a hair transplant, the burning question is which hair transplantation procedure is the best technique. The FUE technique, which refers to “Follicular Unit Extraction” or “Individual Follicle Extraction”, is considered the most advanced hair transplant technique available. The FUE hair transplant technique is surgical variant of the follicular micro transplant technique and it is implemented by extracting the follicles of the donor site on an individual basis without the need of stitches and without leaving scars. These follicular units in groups of 1, 2, 3 or 4 hair groups are extracted in its natural groupings and prepared carefully. As a matter of principle, there is no better technique than another since the form of extraction the follicles from the donor zone by keeping its natural form. Who Are The Good Candidates For The FUE Technique? Patients who want to disguise scars of previous hair transplantation procedures. Extraction of follicles by the FUE technique is much more simple and painless in comparison with other hair transplantation techniques. Primarily, FUE is a minor surgery, classified as a simple medical act. As a heart of the matter, no damage occurs in any follicular unit during extraction. And there is no risk of sensivity loss in donor zone. The size of needles or punches is significant at this point. The success of FUE is derived from the accurate use of the smallest possible punch. Choosing the right size plays a decisive role and it depends on the experience of the implementer. In the meanwhile, the FUE technique is not an invasive surgery, since therefore the hair transplantation zone heals within a couple of days and there is no risk of nerve damage. Patient is allowed to perform sports 8 days later the implementation of FUE surgery. In this period, the units of transplanted folliculars take root in the receiving area. Another benefit of FUE technique is various potential donor zone options all over the body. It is possible with FUE to replace the excessive the hair in other parts of the body and transplant to the desired area. The best quality of hair transplantation is available with the FUE technique. For that matter, after implementation of FUE, the patient is also able to choose any hair style at any time he wishes. After all, the success of all hair transplantation techniques depends on the experience and professionalism of the implementer. For that matter, should you desire the best result after hair transplantation, ask for commitment of natural appearance, extensive experience and good examples served in the past depending on the needs and expectations of previous patients. As a final word, it can be said that FUE technique is more favourable for the patients in the meaning of multiple choice of graft source, fast healing process and %100 guarantee of success. FUE (Follicular Unit Extraction) technique is known as the best and optimal hair transplantation available today. It gives benefit in micro surgery with the smallest micro-scalpels which are less than 1 mm thick used in the process of surgery. By the help of these smallest needles and micro-scalpels, the more number of hairs can be extracted and transplanted in the right angle and direction into the treatment zone. Who Can Have Hair Transplantation By FUE Technique? FUE technique is available for the patients in good health and of all ages who want to have hair transplantation. Another required spesification for those who wants to have FUE is adequate donor area in good quality of dense hair. Should hair transplantation preferred in early ages, it is predicted that further surgery sessions can be required in following ages by hormonal reasons and nonstable hair loss. Also, personal aesthetical expectations may change in time. Ages of 30-40 are expected to give pretty much more satisfactory results for this reason. That’s why, it is highly reccommended to start hair transplantation after the age of 30 not only due to hormonal reasons but also because of changing aesthetical expectations of young people in long years. In order to get the best result after the FUE surgery, the candidates are advised to have these stated qualities checked by a dermatologist. If all qualifications are adequate in your texture structure, then you are a good candidate for implementation of FUE technique. The rest depends on success of treatment in right clinique and by the right implementer. The state of the art technology in FUE technique is the robotic treatment. The 2nd and 3rd generation of robotic FUE technologies are also available. Desire you get the the latest generation of treatment, seek for the latest versions of technology in the hair transplantation clinique as well as the extensive experience of treament team. By means of highly accurate imaging spesification of robotic technology, it is possible to extract more follicular units in a safe way without leaving any trace or scar. We need hardly mention that the effective use of robotic technology requires to be applied by an experienced surgeon for good results. lack of scars are the main advanteges of FUE. Under favor of very required spesifications listed above FUE is highly preferred and advised lately. At latest in two weeks after the application of FUE technique, the patient can resume on his sportive activities including heavy sports. Which Hair Transplantation Technique Is The Best? In this article we would like to discuss the best hair transplantation techniques available. The FUE hair tranplant technique is currently known to be the latest and most advanced hair transplantation method. Especially when used in crown area on head, it gives quick and most advantageous results both in men and women. Patients are able to recover in a very quick way after surgery, just like in 2-4 days. There are several forms of FUE technique depending on the surgical tools used during the procedure. In Gold FUE Technique, the surgical tools used in surgery are made up of gold. Gold is known to be the most coherent material to the human body and the very special gold surgery tools are designed in a very sensitive way. In Perkutan Technique, the micro surgery tools are designed not to damage the application area without leaving any scars or trace. By this means, recovery period gets the shortest ever. The most delicate part of Perkutan Technique is that it needs to be applied by an extense experienced surgeon or surgery team who are highly competent in micro surgery. In comparison with other methods, another strength of Perkutan technique is get shaved is not required. IceGraft Hair Transplantation is made by the help of a special solution that is used to protect and give strength to the grafts obtained from donor site for a while. Hair grafts are soaked in IceGraft solution is a low and constant temperature solution so that the grafts grow and get stronger with substantial components just like in human body. One of the latest and best hair transplantation techniques is DHI (Direct Hair Implementation). In DHI technique, most of the known risks of previous hair transplantation techniques are reduced. On the other hand, preservation of the naturality of hair grafts is the most advategous side of DHI technique. Even if DHI procedure takes a little bit longer than other methods, the recovery time is shorter as there is no surgery cut used, in a very least invasive way. When you decide to have your hair transplanted, there are some clues to take into consideration. There are several weaknesses and strenths of each hair transplantation technique. First of all, one of the most important characteristic of a hair transplantation technique is the surgery method and surgery tools used. Some techniques are pretty much better in making the surgery without leaving any scar or trace. Another very important issue that patients should consider is the recovery time. Some techniques are much more available to provide the fast and shortest recovery for the patients.
what is fue hair transplantation technique? for those who want to have a hair transplant, the burning question is which hair transplantation procedure is the best technique. the fue technique, which refers to “follicular unit extraction” or “individual follicle extraction”, is considered the most advanced hair transplant technique available. the fue hair transplant technique is surgical variant of the follicular micro transplant technique and it is implemented by extracting the follicles of the donor site on an individual basis without the need of stitches and without leaving scars. these follicular units in groups of 1, 2, 3 or 4 hair groups are extracted in its natural groupings and prepared carefully. as a matter of principle, there is no better technique than another since the form of extraction the follicles from the donor zone by keeping its natural form. who are the good candidates for the fue technique? patients who want to disguise scars of previous hair transplantation procedures. extraction of follicles by the fue technique is much more simple and painless in comparison with other hair transplantation techniques. primarily, fue is a minor surgery, classified as a simple medical act. as a heart of the matter, no damage occurs in any follicular unit during extraction. and there is no risk of sensivity loss in donor zone. the size of needles or punches is significant at this point. the success of fue is derived from the accurate use of the smallest possible punch. choosing the right size plays a decisive role and it depends on the experience of the implementer. in the meanwhile, the fue technique is not an invasive surgery, since therefore the hair transplantation zone heals within a couple of days and there is no risk of nerve damage. patient is allowed to perform sports 8 days later the implementation of fue surgery. in this period, the units of transplanted folliculars take root in the receiving area. another benefit of fue technique is various potential donor zone options all over the body. it is possible with fue to replace the excessive the hair in other parts of the body and transplant to the desired area. the best quality of hair transplantation is available with the fue technique. for that matter, after implementation of fue, the patient is also able to choose any hair style at any time he wishes. after all, the success of all hair transplantation techniques depends on the experience and professionalism of the implementer. for that matter, should you desire the best result after hair transplantation, ask for commitment of natural appearance, extensive experience and good examples served in the past depending on the needs and expectations of previous patients. as a final word, it can be said that fue technique is more favourable for the patients in the meaning of multiple choice of graft source, fast healing process and %100 guarantee of success. fue (follicular unit extraction) technique is known as the best and optimal hair transplantation available today. it gives benefit in micro surgery with the smallest micro-scalpels which are less than 1 mm thick used in the process of surgery. by the help of these smallest needles and micro-scalpels, the more number of hairs can be extracted and transplanted in the right angle and direction into the treatment zone. who can have hair transplantation by fue technique? fue technique is available for the patients in good health and of all ages who want to have hair transplantation. another required spesification for those who wants to have fue is adequate donor area in good quality of dense hair. should hair transplantation preferred in early ages, it is predicted that further surgery sessions can be required in following ages by hormonal reasons and nonstable hair loss. also, personal aesthetical expectations may change in time. ages of 30-40 are expected to give pretty much more satisfactory results for this reason. that’s why, it is highly reccommended to start hair transplantation after the age of 30 not only due to hormonal reasons but also because of changing aesthetical expectations of young people in long years. in order to get the best result after the fue surgery, the candidates are advised to have these stated qualities checked by a dermatologist. if all qualifications are adequate in your texture structure, then you are a good candidate for implementation of fue technique. the rest depends on success of treatment in right clinique and by the right implementer. the state of the art technology in fue technique is the robotic treatment. the 2nd and 3rd generation of robotic fue technologies are also available. desire you get the the latest generation of treatment, seek for the latest versions of technology in the hair transplantation clinique as well as the extensive experience of treament team. by means of highly accurate imaging spesification of robotic technology, it is possible to extract more follicular units in a safe way without leaving any trace or scar. we need hardly mention that the effective use of robotic technology requires to be applied by an experienced surgeon for good results. lack of scars are the main advanteges of fue. under favor of very required spesifications listed above fue is highly preferred and advised lately. at latest in two weeks after the application of fue technique, the patient can resume on his sportive activities including heavy sports. which hair transplantation technique is the best? in this article we would like to discuss the best hair transplantation techniques available. the fue hair tranplant technique is currently known to be the latest and most advanced hair transplantation method. especially when used in crown area on head, it gives quick and most advantageous results both in men and women. patients are able to recover in a very quick way after surgery, just like in 2-4 days. there are several forms of fue technique depending on the surgical tools used during the procedure. in gold fue technique, the surgical tools used in surgery are made up of gold. gold is known to be the most coherent material to the human body and the very special gold surgery tools are designed in a very sensitive way. in perkutan technique, the micro surgery tools are designed not to damage the application area without leaving any scars or trace. by this means, recovery period gets the shortest ever. the most delicate part of perkutan technique is that it needs to be applied by an extense experienced surgeon or surgery team who are highly competent in micro surgery. in comparison with other methods, another strength of perkutan technique is get shaved is not required. icegraft hair transplantation is made by the help of a special solution that is used to protect and give strength to the grafts obtained from donor site for a while. hair grafts are soaked in icegraft solution is a low and constant temperature solution so that the grafts grow and get stronger with substantial components just like in human body. one of the latest and best hair transplantation techniques is dhi (direct hair implementation). in dhi technique, most of the known risks of previous hair transplantation techniques are reduced. on the other hand, preservation of the naturality of hair grafts is the most advategous side of dhi technique. even if dhi procedure takes a little bit longer than other methods, the recovery time is shorter as there is no surgery cut used, in a very least invasive way. when you decide to have your hair transplanted, there are some clues to take into consideration. there are several weaknesses and strenths of each hair transplantation technique. first of all, one of the most important characteristic of a hair transplantation technique is the surgery method and surgery tools used. some techniques are pretty much better in making the surgery without leaving any scar or trace. another very important issue that patients should consider is the recovery time. some techniques are much more available to provide the fast and shortest recovery for the patients.
Betting tips for every race at Mackay. Today’s best bet is in race 5. Track specialist that just keeps on winning and can win again and make it six straight on the trot. Sat behind the speed then exploded when the gap appears to add to its impressive resume last time out at Townsville. Will look to settle behind the speed and just watch him explode in the straight. Aother win is on the agenda. The one to beat!
betting tips for every race at mackay. today’s best bet is in race 5. track specialist that just keeps on winning and can win again and make it six straight on the trot. sat behind the speed then exploded when the gap appears to add to its impressive resume last time out at townsville. will look to settle behind the speed and just watch him explode in the straight. aother win is on the agenda. the one to beat!