Update README.md

README.md

@@ -174,15 +174,15 @@ Reference:
 - https://ftp.uniprot.org/pub/databases/uniprot/previous_releases/release-2022_01/knowledgebase/UniProtKB_SwissProt-relstat.html
 - https://ftp.uniprot.org/pub/databases/uniprot/previous_releases/release-2023_05/knowledgebase/UniProtKB_SwissProt-relstat.html
 
-## Dataset Description
+<!-- ## Dataset Description -->
 
-- **Homepage:** 
+<!-- - **Homepage:** 
 - **Repository:** 
 - **Paper:** 
 - **Leaderboard:** 
-- **Point of Contact:** 
+- **Point of Contact:**  -->
 
-### Dataset Overview
+## Dataset Overview
 We are excited to announce the release of the OPI dataset, a curated collection of instructions covering 9 tasks for adapting LLMs to protein biology, containing 1.61M samples. The dataset is designed to advance LLM-driven research in the field of protein biology. We welcome contributions and enhancements to this dataset from the community.
 
 Open Protein Instructions(OPI) is the initial part of Open Biology Instructions(OBI) project, together with the subsequent Open Molecule Instructions(OMI), Open DNA Instructions(ODI), Open RNA Instructions(ORI) and Open Single-cell Instructions (OSCI). OBI is a project which aims to fully leverage the potential ability of Large Language Models(LLMs), especially the scientific LLMs like Galactica, to facilitate research in AI for Life Science community. While OBI is still in an early stage, we hope to provide a starting point for the community to bridge LLMs and biological domain knowledge.
@@ -270,7 +270,8 @@ output:
 ```
 - **An example of OPI testing data:**
 ```
-{"id": "seed_task_0", "name": "EC number of price dataset from CLEAN", "instruction": "Return the EC number of the protein sequence.", "instances": [{"input":
+{"id": "seed_task_0", "name": "EC number of price dataset from CLEAN", "instruction":
+"Return the EC number of the protein sequence.", "instances": [{"input":
 "MAIPPYPDFRSAAFLRQHLRATMAFYDPVATDASGGQFHFFLDDGTVYNTHTRHLVSATRFVVTHAMLYRTTGEARYQVGMRHALEFLRTAFLDPATGGY
 AWLIDWQDGRATVQDTTRHCYGMAFVMLAYARAYEAGVPEARVWLAEAFDTAEQHFWQPAAGLYADEASPDWQLTSYRGQNANMHACEAMISAFRATGERR
 YIERAEQLAQGICQRQAALSDRTHAPAAEGWVWEHFHADWSVDWDYNRHDRSNIFRPWGYQVGHQTEWAKLLLQLDALLPADWHLPCAQRLFDTAVERGWD