|
--- |
|
license: cc-by-nc-nd-4.0 |
|
--- |
|
# FusOn-pLM: A Fusion Oncoprotein-Specific Language Model via Focused Probabilistic Masking |
|
 |
|
In this work, we introduce **FusOn-pLM**, a novel pLM that fine-tunes the state-of-the-art [ESM-2-650M](https://huggingface.co/facebook/esm2_t33_650M_UR50D) protein language model (pLM) on fusion oncoprotein sequences, those that drive a large portion of pediatric cancers but are heavily disordered and undruggable. We specifically introduce a novel masked language modeling (MLM) strategy, employing a binding-site probability predictor to focus masking on key amino acid residues, thereby generating more optimal fusion oncoprotein-aware embeddings. Our model improves performance on both fusion oncoprotein-specific benchmarks and disorder prediction tasks in comparison to baseline ESM-2 representations, as well as manually-constructed biophysical embeddings, motivating downstream usage of FusOn-pLM embeddings for therapeutic design tasks targeting these fusions. Please feel free to try out our embeddings and reach out if you have any questions! |
|
|
|
|
|
**How to generate FusOn-pLM embeddings for your fusion oncoprotein:** |
|
|
|
``` |
|
from transformers import AutoTokenizer, AutoModel |
|
import logging |
|
import torch |
|
|
|
# Suppress warnings about newly initialized 'esm.pooler.dense.bias', 'esm.pooler.dense.weight' layers - these are not used to extract embeddings |
|
logging.getLogger("transformers.modeling_utils").setLevel(logging.ERROR) |
|
|
|
# Set device |
|
device = torch.device("cuda" if torch.cuda.is_available() else "cpu") |
|
print(f"Using device: {device}") |
|
|
|
# Load the tokenizer and model |
|
model_name = "ChatterjeeLab/FusOn-pLM" |
|
tokenizer = AutoTokenizer.from_pretrained(model_name) |
|
model = AutoModel.from_pretrained(model_name) |
|
model.to(device) |
|
model.eval() |
|
|
|
# Example fusion oncoprotein sequence: MLLT10:PICALM, associated with Acute Myeloid Leukemia (LAML) |
|
# Amino acids 1-80 are derived from the head gene, MLLT10 |
|
# Amino acids 81-119 are derived from the tail gene, PICALM |
|
sequence = "MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRKCESQERAARVPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM" |
|
|
|
# Tokenize the input sequence |
|
inputs = tokenizer(sequence, return_tensors="pt", padding=True, truncation=True,max_length=2000) |
|
inputs = {k: v.to(device) for k, v in inputs.items()} |
|
|
|
# Get the embeddings |
|
with torch.no_grad(): |
|
outputs = model(**inputs) |
|
# The embeddings are in the last_hidden_state tensor |
|
embeddings = outputs.last_hidden_state |
|
# remove extra dimension |
|
embeddings = embeddings.squeeze(0) |
|
# remove BOS and EOS tokens |
|
embeddings = embeddings[1:-1, :] |
|
|
|
# Convert embeddings to numpy array (if needed) |
|
embeddings = embeddings.cpu().numpy() |
|
|
|
print("Per-residue embeddings shape:", embeddings.shape) |
|
|
|
``` |
|
|
|
## Repository Authors |
|
|
|
[Sophia Vincoff](mailto:[email protected]), PhD Student at Duke University <br> |
|
[Pranam Chatterjee](mailto:[email protected]), Assistant Professor at Duke University |
|
|
|
Reach out to us with any questions! |