End of training
Browse files- 1_Pooling/config.json +10 -0
 - README.md +396 -0
 - config.json +25 -0
 - config_sentence_transformers.json +10 -0
 - model.safetensors +3 -0
 - modules.json +20 -0
 - runs/Jun16_15-17-17_snark.fritz.box/events.out.tfevents.1750079839.snark.fritz.box.61972.0 +3 -0
 - sentence_bert_config.json +4 -0
 - special_tokens_map.json +37 -0
 - tokenizer.json +0 -0
 - tokenizer_config.json +65 -0
 - training_args.bin +3 -0
 - vocab.txt +0 -0
 
    	
        1_Pooling/config.json
    ADDED
    
    | 
         @@ -0,0 +1,10 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "word_embedding_dimension": 384,
         
     | 
| 3 | 
         
            +
              "pooling_mode_cls_token": false,
         
     | 
| 4 | 
         
            +
              "pooling_mode_mean_tokens": true,
         
     | 
| 5 | 
         
            +
              "pooling_mode_max_tokens": false,
         
     | 
| 6 | 
         
            +
              "pooling_mode_mean_sqrt_len_tokens": false,
         
     | 
| 7 | 
         
            +
              "pooling_mode_weightedmean_tokens": false,
         
     | 
| 8 | 
         
            +
              "pooling_mode_lasttoken": false,
         
     | 
| 9 | 
         
            +
              "include_prompt": true
         
     | 
| 10 | 
         
            +
            }
         
     | 
    	
        README.md
    ADDED
    
    | 
         @@ -0,0 +1,396 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            ---
         
     | 
| 2 | 
         
            +
            tags:
         
     | 
| 3 | 
         
            +
            - sentence-transformers
         
     | 
| 4 | 
         
            +
            - sentence-similarity
         
     | 
| 5 | 
         
            +
            - feature-extraction
         
     | 
| 6 | 
         
            +
            - generated_from_trainer
         
     | 
| 7 | 
         
            +
            - dataset_size:100
         
     | 
| 8 | 
         
            +
            - loss:MatryoshkaLoss
         
     | 
| 9 | 
         
            +
            - loss:MultipleNegativesRankingLoss
         
     | 
| 10 | 
         
            +
            base_model: sentence-transformers/all-MiniLM-L6-v2
         
     | 
| 11 | 
         
            +
            widget:
         
     | 
| 12 | 
         
            +
            - source_sentence: <start> TYTGGHJJUUYHTRRGGGRRDREDEERFED <end>
         
     | 
| 13 | 
         
            +
              sentences:
         
     | 
| 14 | 
         
            +
              - published
         
     | 
| 15 | 
         
            +
              - published
         
     | 
| 16 | 
         
            +
              - The
         
     | 
| 17 | 
         
            +
            - source_sentence: <start> GTYHYYHHHYYHGFFFTTTRRFERREEDDW <end>
         
     | 
| 18 | 
         
            +
              sentences:
         
     | 
| 19 | 
         
            +
              - B.
         
     | 
| 20 | 
         
            +
              - The
         
     | 
| 21 | 
         
            +
              - Spencers
         
     | 
| 22 | 
         
            +
            - source_sentence: The <start> LLMKIMYVERDWDERFTTTRFRRREEEERR <end> was later published
         
     | 
| 23 | 
         
            +
                on Richard B.
         
     | 
| 24 | 
         
            +
              sentences:
         
     | 
| 25 | 
         
            +
              - The
         
     | 
| 26 | 
         
            +
              - Spencers
         
     | 
| 27 | 
         
            +
              - letter
         
     | 
| 28 | 
         
            +
            - source_sentence: The letter <start> WQWEWWWWDSAAWWSSAAZXZSSXXXDDSQ <end> later published
         
     | 
| 29 | 
         
            +
                on Richard B.
         
     | 
| 30 | 
         
            +
              sentences:
         
     | 
| 31 | 
         
            +
              - The
         
     | 
| 32 | 
         
            +
              - The
         
     | 
| 33 | 
         
            +
              - was
         
     | 
| 34 | 
         
            +
            - source_sentence: The letter was <start> PLJUGRFVAAQAWQSFRFYTTRREEDDEGR <end> published
         
     | 
| 35 | 
         
            +
                on Richard B.
         
     | 
| 36 | 
         
            +
              sentences:
         
     | 
| 37 | 
         
            +
              - later
         
     | 
| 38 | 
         
            +
              - letter
         
     | 
| 39 | 
         
            +
              - The
         
     | 
| 40 | 
         
            +
            pipeline_tag: sentence-similarity
         
     | 
| 41 | 
         
            +
            library_name: sentence-transformers
         
     | 
| 42 | 
         
            +
            ---
         
     | 
| 43 | 
         
            +
             
     | 
| 44 | 
         
            +
            # SentenceTransformer based on sentence-transformers/all-MiniLM-L6-v2
         
     | 
| 45 | 
         
            +
             
     | 
| 46 | 
         
            +
            This is a [sentence-transformers](https://www.SBERT.net) model finetuned from [sentence-transformers/all-MiniLM-L6-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) on the generator dataset. It maps sentences & paragraphs to a 384-dimensional dense vector space and can be used for semantic textual similarity, semantic search, paraphrase mining, text classification, clustering, and more.
         
     | 
| 47 | 
         
            +
             
     | 
| 48 | 
         
            +
            ## Model Details
         
     | 
| 49 | 
         
            +
             
     | 
| 50 | 
         
            +
            ### Model Description
         
     | 
| 51 | 
         
            +
            - **Model Type:** Sentence Transformer
         
     | 
| 52 | 
         
            +
            - **Base model:** [sentence-transformers/all-MiniLM-L6-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) <!-- at revision c9745ed1d9f207416be6d2e6f8de32d1f16199bf -->
         
     | 
| 53 | 
         
            +
            - **Maximum Sequence Length:** 256 tokens
         
     | 
| 54 | 
         
            +
            - **Output Dimensionality:** 384 dimensions
         
     | 
| 55 | 
         
            +
            - **Similarity Function:** Cosine Similarity
         
     | 
| 56 | 
         
            +
            - **Training Dataset:**
         
     | 
| 57 | 
         
            +
                - generator
         
     | 
| 58 | 
         
            +
            <!-- - **Language:** Unknown -->
         
     | 
| 59 | 
         
            +
            <!-- - **License:** Unknown -->
         
     | 
| 60 | 
         
            +
             
     | 
| 61 | 
         
            +
            ### Model Sources
         
     | 
| 62 | 
         
            +
             
     | 
| 63 | 
         
            +
            - **Documentation:** [Sentence Transformers Documentation](https://sbert.net)
         
     | 
| 64 | 
         
            +
            - **Repository:** [Sentence Transformers on GitHub](https://github.com/UKPLab/sentence-transformers)
         
     | 
| 65 | 
         
            +
            - **Hugging Face:** [Sentence Transformers on Hugging Face](https://huggingface.co/models?library=sentence-transformers)
         
     | 
| 66 | 
         
            +
             
     | 
| 67 | 
         
            +
            ### Full Model Architecture
         
     | 
| 68 | 
         
            +
             
     | 
| 69 | 
         
            +
            ```
         
     | 
| 70 | 
         
            +
            SentenceTransformer(
         
     | 
| 71 | 
         
            +
              (0): Transformer({'max_seq_length': 256, 'do_lower_case': False}) with Transformer model: BertModel 
         
     | 
| 72 | 
         
            +
              (1): Pooling({'word_embedding_dimension': 384, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False, 'pooling_mode_weightedmean_tokens': False, 'pooling_mode_lasttoken': False, 'include_prompt': True})
         
     | 
| 73 | 
         
            +
              (2): Normalize()
         
     | 
| 74 | 
         
            +
            )
         
     | 
| 75 | 
         
            +
            ```
         
     | 
| 76 | 
         
            +
             
     | 
| 77 | 
         
            +
            ## Usage
         
     | 
| 78 | 
         
            +
             
     | 
| 79 | 
         
            +
            ### Direct Usage (Sentence Transformers)
         
     | 
| 80 | 
         
            +
             
     | 
| 81 | 
         
            +
            First install the Sentence Transformers library:
         
     | 
| 82 | 
         
            +
             
     | 
| 83 | 
         
            +
            ```bash
         
     | 
| 84 | 
         
            +
            pip install -U sentence-transformers
         
     | 
| 85 | 
         
            +
            ```
         
     | 
| 86 | 
         
            +
             
     | 
| 87 | 
         
            +
            Then you can load this model and run inference.
         
     | 
| 88 | 
         
            +
            ```python
         
     | 
| 89 | 
         
            +
            from sentence_transformers import SentenceTransformer
         
     | 
| 90 | 
         
            +
             
     | 
| 91 | 
         
            +
            # Download from the 🤗 Hub
         
     | 
| 92 | 
         
            +
            model = SentenceTransformer("checkpoints")
         
     | 
| 93 | 
         
            +
            # Run inference
         
     | 
| 94 | 
         
            +
            sentences = [
         
     | 
| 95 | 
         
            +
                'The letter was <start> PLJUGRFVAAQAWQSFRFYTTRREEDDEGR <end> published on Richard B.',
         
     | 
| 96 | 
         
            +
                'later',
         
     | 
| 97 | 
         
            +
                'The',
         
     | 
| 98 | 
         
            +
            ]
         
     | 
| 99 | 
         
            +
            embeddings = model.encode(sentences)
         
     | 
| 100 | 
         
            +
            print(embeddings.shape)
         
     | 
| 101 | 
         
            +
            # [3, 384]
         
     | 
| 102 | 
         
            +
             
     | 
| 103 | 
         
            +
            # Get the similarity scores for the embeddings
         
     | 
| 104 | 
         
            +
            similarities = model.similarity(embeddings, embeddings)
         
     | 
| 105 | 
         
            +
            print(similarities.shape)
         
     | 
| 106 | 
         
            +
            # [3, 3]
         
     | 
| 107 | 
         
            +
            ```
         
     | 
| 108 | 
         
            +
             
     | 
| 109 | 
         
            +
            <!--
         
     | 
| 110 | 
         
            +
            ### Direct Usage (Transformers)
         
     | 
| 111 | 
         
            +
             
     | 
| 112 | 
         
            +
            <details><summary>Click to see the direct usage in Transformers</summary>
         
     | 
| 113 | 
         
            +
             
     | 
| 114 | 
         
            +
            </details>
         
     | 
| 115 | 
         
            +
            -->
         
     | 
| 116 | 
         
            +
             
     | 
| 117 | 
         
            +
            <!--
         
     | 
| 118 | 
         
            +
            ### Downstream Usage (Sentence Transformers)
         
     | 
| 119 | 
         
            +
             
     | 
| 120 | 
         
            +
            You can finetune this model on your own dataset.
         
     | 
| 121 | 
         
            +
             
     | 
| 122 | 
         
            +
            <details><summary>Click to expand</summary>
         
     | 
| 123 | 
         
            +
             
     | 
| 124 | 
         
            +
            </details>
         
     | 
| 125 | 
         
            +
            -->
         
     | 
| 126 | 
         
            +
             
     | 
| 127 | 
         
            +
            <!--
         
     | 
| 128 | 
         
            +
            ### Out-of-Scope Use
         
     | 
| 129 | 
         
            +
             
     | 
| 130 | 
         
            +
            *List how the model may foreseeably be misused and address what users ought not to do with the model.*
         
     | 
| 131 | 
         
            +
            -->
         
     | 
| 132 | 
         
            +
             
     | 
| 133 | 
         
            +
            <!--
         
     | 
| 134 | 
         
            +
            ## Bias, Risks and Limitations
         
     | 
| 135 | 
         
            +
             
     | 
| 136 | 
         
            +
            *What are the known or foreseeable issues stemming from this model? You could also flag here known failure cases or weaknesses of the model.*
         
     | 
| 137 | 
         
            +
            -->
         
     | 
| 138 | 
         
            +
             
     | 
| 139 | 
         
            +
            <!--
         
     | 
| 140 | 
         
            +
            ### Recommendations
         
     | 
| 141 | 
         
            +
             
     | 
| 142 | 
         
            +
            *What are recommendations with respect to the foreseeable issues? For example, filtering explicit content.*
         
     | 
| 143 | 
         
            +
            -->
         
     | 
| 144 | 
         
            +
             
     | 
| 145 | 
         
            +
            ## Training Details
         
     | 
| 146 | 
         
            +
             
     | 
| 147 | 
         
            +
            ### Training Dataset
         
     | 
| 148 | 
         
            +
             
     | 
| 149 | 
         
            +
            #### generator
         
     | 
| 150 | 
         
            +
             
     | 
| 151 | 
         
            +
            * Dataset: generator
         
     | 
| 152 | 
         
            +
            * Size: 100 training samples
         
     | 
| 153 | 
         
            +
            * Columns: <code>anchor</code> and <code>positive</code>
         
     | 
| 154 | 
         
            +
            * Approximate statistics based on the first 100 samples:
         
     | 
| 155 | 
         
            +
              |         | anchor                                                                             | positive                                                                       |
         
     | 
| 156 | 
         
            +
              |:--------|:-----------------------------------------------------------------------------------|:-------------------------------------------------------------------------------|
         
     | 
| 157 | 
         
            +
              | type    | string                                                                             | string                                                                         |
         
     | 
| 158 | 
         
            +
              | details | <ul><li>min: 23 tokens</li><li>mean: 30.92 tokens</li><li>max: 36 tokens</li></ul> | <ul><li>min: 3 tokens</li><li>mean: 3.2 tokens</li><li>max: 4 tokens</li></ul> |
         
     | 
| 159 | 
         
            +
            * Samples:
         
     | 
| 160 | 
         
            +
              | anchor                                                    | positive         |
         
     | 
| 161 | 
         
            +
              |:----------------------------------------------------------|:-----------------|
         
     | 
| 162 | 
         
            +
              | <code><start> YGHGYYJHHHGRRERRERRDEERWWSWWER <end></code> | <code>The</code> |
         
     | 
| 163 | 
         
            +
              | <code><start> GRHHHGYHBJYGGGDTRRRRRRFFEEEEDE <end></code> | <code>The</code> |
         
     | 
| 164 | 
         
            +
              | <code><start> TTYHYJJMJJYHHYTRRFRRRRRTREEERW <end></code> | <code>The</code> |
         
     | 
| 165 | 
         
            +
            * Loss: [<code>MatryoshkaLoss</code>](https://sbert.net/docs/package_reference/sentence_transformer/losses.html#matryoshkaloss) with these parameters:
         
     | 
| 166 | 
         
            +
              ```json
         
     | 
| 167 | 
         
            +
              {
         
     | 
| 168 | 
         
            +
                  "loss": "MultipleNegativesRankingLoss",
         
     | 
| 169 | 
         
            +
                  "matryoshka_dims": [
         
     | 
| 170 | 
         
            +
                      384,
         
     | 
| 171 | 
         
            +
                      64
         
     | 
| 172 | 
         
            +
                  ],
         
     | 
| 173 | 
         
            +
                  "matryoshka_weights": [
         
     | 
| 174 | 
         
            +
                      1,
         
     | 
| 175 | 
         
            +
                      1
         
     | 
| 176 | 
         
            +
                  ],
         
     | 
| 177 | 
         
            +
                  "n_dims_per_step": -1
         
     | 
| 178 | 
         
            +
              }
         
     | 
| 179 | 
         
            +
              ```
         
     | 
| 180 | 
         
            +
             
     | 
| 181 | 
         
            +
            ### Training Hyperparameters
         
     | 
| 182 | 
         
            +
            #### Non-Default Hyperparameters
         
     | 
| 183 | 
         
            +
             
     | 
| 184 | 
         
            +
            - `eval_strategy`: steps
         
     | 
| 185 | 
         
            +
            - `per_device_train_batch_size`: 4
         
     | 
| 186 | 
         
            +
            - `per_device_eval_batch_size`: 1
         
     | 
| 187 | 
         
            +
            - `learning_rate`: 2e-05
         
     | 
| 188 | 
         
            +
            - `weight_decay`: 0.01
         
     | 
| 189 | 
         
            +
            - `num_train_epochs`: 4
         
     | 
| 190 | 
         
            +
            - `lr_scheduler_type`: cosine
         
     | 
| 191 | 
         
            +
            - `warmup_ratio`: 0.1
         
     | 
| 192 | 
         
            +
            - `tf32`: False
         
     | 
| 193 | 
         
            +
            - `load_best_model_at_end`: True
         
     | 
| 194 | 
         
            +
            - `optim`: adamw_torch_fused
         
     | 
| 195 | 
         
            +
             
     | 
| 196 | 
         
            +
            #### All Hyperparameters
         
     | 
| 197 | 
         
            +
            <details><summary>Click to expand</summary>
         
     | 
| 198 | 
         
            +
             
     | 
| 199 | 
         
            +
            - `overwrite_output_dir`: False
         
     | 
| 200 | 
         
            +
            - `do_predict`: False
         
     | 
| 201 | 
         
            +
            - `eval_strategy`: steps
         
     | 
| 202 | 
         
            +
            - `prediction_loss_only`: True
         
     | 
| 203 | 
         
            +
            - `per_device_train_batch_size`: 4
         
     | 
| 204 | 
         
            +
            - `per_device_eval_batch_size`: 1
         
     | 
| 205 | 
         
            +
            - `per_gpu_train_batch_size`: None
         
     | 
| 206 | 
         
            +
            - `per_gpu_eval_batch_size`: None
         
     | 
| 207 | 
         
            +
            - `gradient_accumulation_steps`: 1
         
     | 
| 208 | 
         
            +
            - `eval_accumulation_steps`: None
         
     | 
| 209 | 
         
            +
            - `torch_empty_cache_steps`: None
         
     | 
| 210 | 
         
            +
            - `learning_rate`: 2e-05
         
     | 
| 211 | 
         
            +
            - `weight_decay`: 0.01
         
     | 
| 212 | 
         
            +
            - `adam_beta1`: 0.9
         
     | 
| 213 | 
         
            +
            - `adam_beta2`: 0.999
         
     | 
| 214 | 
         
            +
            - `adam_epsilon`: 1e-08
         
     | 
| 215 | 
         
            +
            - `max_grad_norm`: 1.0
         
     | 
| 216 | 
         
            +
            - `num_train_epochs`: 4
         
     | 
| 217 | 
         
            +
            - `max_steps`: -1
         
     | 
| 218 | 
         
            +
            - `lr_scheduler_type`: cosine
         
     | 
| 219 | 
         
            +
            - `lr_scheduler_kwargs`: {}
         
     | 
| 220 | 
         
            +
            - `warmup_ratio`: 0.1
         
     | 
| 221 | 
         
            +
            - `warmup_steps`: 0
         
     | 
| 222 | 
         
            +
            - `log_level`: passive
         
     | 
| 223 | 
         
            +
            - `log_level_replica`: warning
         
     | 
| 224 | 
         
            +
            - `log_on_each_node`: True
         
     | 
| 225 | 
         
            +
            - `logging_nan_inf_filter`: True
         
     | 
| 226 | 
         
            +
            - `save_safetensors`: True
         
     | 
| 227 | 
         
            +
            - `save_on_each_node`: False
         
     | 
| 228 | 
         
            +
            - `save_only_model`: False
         
     | 
| 229 | 
         
            +
            - `restore_callback_states_from_checkpoint`: False
         
     | 
| 230 | 
         
            +
            - `no_cuda`: False
         
     | 
| 231 | 
         
            +
            - `use_cpu`: False
         
     | 
| 232 | 
         
            +
            - `use_mps_device`: False
         
     | 
| 233 | 
         
            +
            - `seed`: 42
         
     | 
| 234 | 
         
            +
            - `data_seed`: None
         
     | 
| 235 | 
         
            +
            - `jit_mode_eval`: False
         
     | 
| 236 | 
         
            +
            - `use_ipex`: False
         
     | 
| 237 | 
         
            +
            - `bf16`: False
         
     | 
| 238 | 
         
            +
            - `fp16`: False
         
     | 
| 239 | 
         
            +
            - `fp16_opt_level`: O1
         
     | 
| 240 | 
         
            +
            - `half_precision_backend`: auto
         
     | 
| 241 | 
         
            +
            - `bf16_full_eval`: False
         
     | 
| 242 | 
         
            +
            - `fp16_full_eval`: False
         
     | 
| 243 | 
         
            +
            - `tf32`: False
         
     | 
| 244 | 
         
            +
            - `local_rank`: 0
         
     | 
| 245 | 
         
            +
            - `ddp_backend`: None
         
     | 
| 246 | 
         
            +
            - `tpu_num_cores`: None
         
     | 
| 247 | 
         
            +
            - `tpu_metrics_debug`: False
         
     | 
| 248 | 
         
            +
            - `debug`: []
         
     | 
| 249 | 
         
            +
            - `dataloader_drop_last`: False
         
     | 
| 250 | 
         
            +
            - `dataloader_num_workers`: 0
         
     | 
| 251 | 
         
            +
            - `dataloader_prefetch_factor`: None
         
     | 
| 252 | 
         
            +
            - `past_index`: -1
         
     | 
| 253 | 
         
            +
            - `disable_tqdm`: False
         
     | 
| 254 | 
         
            +
            - `remove_unused_columns`: True
         
     | 
| 255 | 
         
            +
            - `label_names`: None
         
     | 
| 256 | 
         
            +
            - `load_best_model_at_end`: True
         
     | 
| 257 | 
         
            +
            - `ignore_data_skip`: False
         
     | 
| 258 | 
         
            +
            - `fsdp`: []
         
     | 
| 259 | 
         
            +
            - `fsdp_min_num_params`: 0
         
     | 
| 260 | 
         
            +
            - `fsdp_config`: {'min_num_params': 0, 'xla': False, 'xla_fsdp_v2': False, 'xla_fsdp_grad_ckpt': False}
         
     | 
| 261 | 
         
            +
            - `fsdp_transformer_layer_cls_to_wrap`: None
         
     | 
| 262 | 
         
            +
            - `accelerator_config`: {'split_batches': False, 'dispatch_batches': None, 'even_batches': True, 'use_seedable_sampler': True, 'non_blocking': False, 'gradient_accumulation_kwargs': None}
         
     | 
| 263 | 
         
            +
            - `deepspeed`: None
         
     | 
| 264 | 
         
            +
            - `label_smoothing_factor`: 0.0
         
     | 
| 265 | 
         
            +
            - `optim`: adamw_torch_fused
         
     | 
| 266 | 
         
            +
            - `optim_args`: None
         
     | 
| 267 | 
         
            +
            - `adafactor`: False
         
     | 
| 268 | 
         
            +
            - `group_by_length`: False
         
     | 
| 269 | 
         
            +
            - `length_column_name`: length
         
     | 
| 270 | 
         
            +
            - `ddp_find_unused_parameters`: None
         
     | 
| 271 | 
         
            +
            - `ddp_bucket_cap_mb`: None
         
     | 
| 272 | 
         
            +
            - `ddp_broadcast_buffers`: False
         
     | 
| 273 | 
         
            +
            - `dataloader_pin_memory`: True
         
     | 
| 274 | 
         
            +
            - `dataloader_persistent_workers`: False
         
     | 
| 275 | 
         
            +
            - `skip_memory_metrics`: True
         
     | 
| 276 | 
         
            +
            - `use_legacy_prediction_loop`: False
         
     | 
| 277 | 
         
            +
            - `push_to_hub`: False
         
     | 
| 278 | 
         
            +
            - `resume_from_checkpoint`: None
         
     | 
| 279 | 
         
            +
            - `hub_model_id`: None
         
     | 
| 280 | 
         
            +
            - `hub_strategy`: every_save
         
     | 
| 281 | 
         
            +
            - `hub_private_repo`: None
         
     | 
| 282 | 
         
            +
            - `hub_always_push`: False
         
     | 
| 283 | 
         
            +
            - `gradient_checkpointing`: False
         
     | 
| 284 | 
         
            +
            - `gradient_checkpointing_kwargs`: None
         
     | 
| 285 | 
         
            +
            - `include_inputs_for_metrics`: False
         
     | 
| 286 | 
         
            +
            - `include_for_metrics`: []
         
     | 
| 287 | 
         
            +
            - `eval_do_concat_batches`: True
         
     | 
| 288 | 
         
            +
            - `fp16_backend`: auto
         
     | 
| 289 | 
         
            +
            - `push_to_hub_model_id`: None
         
     | 
| 290 | 
         
            +
            - `push_to_hub_organization`: None
         
     | 
| 291 | 
         
            +
            - `mp_parameters`: 
         
     | 
| 292 | 
         
            +
            - `auto_find_batch_size`: False
         
     | 
| 293 | 
         
            +
            - `full_determinism`: False
         
     | 
| 294 | 
         
            +
            - `torchdynamo`: None
         
     | 
| 295 | 
         
            +
            - `ray_scope`: last
         
     | 
| 296 | 
         
            +
            - `ddp_timeout`: 1800
         
     | 
| 297 | 
         
            +
            - `torch_compile`: False
         
     | 
| 298 | 
         
            +
            - `torch_compile_backend`: None
         
     | 
| 299 | 
         
            +
            - `torch_compile_mode`: None
         
     | 
| 300 | 
         
            +
            - `include_tokens_per_second`: False
         
     | 
| 301 | 
         
            +
            - `include_num_input_tokens_seen`: False
         
     | 
| 302 | 
         
            +
            - `neftune_noise_alpha`: None
         
     | 
| 303 | 
         
            +
            - `optim_target_modules`: None
         
     | 
| 304 | 
         
            +
            - `batch_eval_metrics`: False
         
     | 
| 305 | 
         
            +
            - `eval_on_start`: False
         
     | 
| 306 | 
         
            +
            - `use_liger_kernel`: False
         
     | 
| 307 | 
         
            +
            - `eval_use_gather_object`: False
         
     | 
| 308 | 
         
            +
            - `average_tokens_across_devices`: False
         
     | 
| 309 | 
         
            +
            - `prompts`: None
         
     | 
| 310 | 
         
            +
            - `batch_sampler`: batch_sampler
         
     | 
| 311 | 
         
            +
            - `multi_dataset_batch_sampler`: proportional
         
     | 
| 312 | 
         
            +
             
     | 
| 313 | 
         
            +
            </details>
         
     | 
| 314 | 
         
            +
             
     | 
| 315 | 
         
            +
            ### Training Logs
         
     | 
| 316 | 
         
            +
            | Epoch | Step | Training Loss |
         
     | 
| 317 | 
         
            +
            |:-----:|:----:|:-------------:|
         
     | 
| 318 | 
         
            +
            | 0.4   | 10   | 5.9732        |
         
     | 
| 319 | 
         
            +
            | 0.8   | 20   | 5.0213        |
         
     | 
| 320 | 
         
            +
            | 1.2   | 30   | 2.5663        |
         
     | 
| 321 | 
         
            +
            | 1.6   | 40   | 2.3414        |
         
     | 
| 322 | 
         
            +
            | 2.0   | 50   | 1.6479        |
         
     | 
| 323 | 
         
            +
            | 2.4   | 60   | 1.4191        |
         
     | 
| 324 | 
         
            +
            | 2.8   | 70   | 1.4435        |
         
     | 
| 325 | 
         
            +
            | 3.2   | 80   | 1.5457        |
         
     | 
| 326 | 
         
            +
            | 3.6   | 90   | 1.3226        |
         
     | 
| 327 | 
         
            +
            | 4.0   | 100  | 1.1394        |
         
     | 
| 328 | 
         
            +
             
     | 
| 329 | 
         
            +
             
     | 
| 330 | 
         
            +
            ### Framework Versions
         
     | 
| 331 | 
         
            +
            - Python: 3.11.13
         
     | 
| 332 | 
         
            +
            - Sentence Transformers: 4.1.0
         
     | 
| 333 | 
         
            +
            - Transformers: 4.52.4
         
     | 
| 334 | 
         
            +
            - PyTorch: 2.7.1
         
     | 
| 335 | 
         
            +
            - Accelerate: 1.7.0
         
     | 
| 336 | 
         
            +
            - Datasets: 3.6.0
         
     | 
| 337 | 
         
            +
            - Tokenizers: 0.21.1
         
     | 
| 338 | 
         
            +
             
     | 
| 339 | 
         
            +
            ## Citation
         
     | 
| 340 | 
         
            +
             
     | 
| 341 | 
         
            +
            ### BibTeX
         
     | 
| 342 | 
         
            +
             
     | 
| 343 | 
         
            +
            #### Sentence Transformers
         
     | 
| 344 | 
         
            +
            ```bibtex
         
     | 
| 345 | 
         
            +
            @inproceedings{reimers-2019-sentence-bert,
         
     | 
| 346 | 
         
            +
                title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks",
         
     | 
| 347 | 
         
            +
                author = "Reimers, Nils and Gurevych, Iryna",
         
     | 
| 348 | 
         
            +
                booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing",
         
     | 
| 349 | 
         
            +
                month = "11",
         
     | 
| 350 | 
         
            +
                year = "2019",
         
     | 
| 351 | 
         
            +
                publisher = "Association for Computational Linguistics",
         
     | 
| 352 | 
         
            +
                url = "https://arxiv.org/abs/1908.10084",
         
     | 
| 353 | 
         
            +
            }
         
     | 
| 354 | 
         
            +
            ```
         
     | 
| 355 | 
         
            +
             
     | 
| 356 | 
         
            +
            #### MatryoshkaLoss
         
     | 
| 357 | 
         
            +
            ```bibtex
         
     | 
| 358 | 
         
            +
            @misc{kusupati2024matryoshka,
         
     | 
| 359 | 
         
            +
                title={Matryoshka Representation Learning},
         
     | 
| 360 | 
         
            +
                author={Aditya Kusupati and Gantavya Bhatt and Aniket Rege and Matthew Wallingford and Aditya Sinha and Vivek Ramanujan and William Howard-Snyder and Kaifeng Chen and Sham Kakade and Prateek Jain and Ali Farhadi},
         
     | 
| 361 | 
         
            +
                year={2024},
         
     | 
| 362 | 
         
            +
                eprint={2205.13147},
         
     | 
| 363 | 
         
            +
                archivePrefix={arXiv},
         
     | 
| 364 | 
         
            +
                primaryClass={cs.LG}
         
     | 
| 365 | 
         
            +
            }
         
     | 
| 366 | 
         
            +
            ```
         
     | 
| 367 | 
         
            +
             
     | 
| 368 | 
         
            +
            #### MultipleNegativesRankingLoss
         
     | 
| 369 | 
         
            +
            ```bibtex
         
     | 
| 370 | 
         
            +
            @misc{henderson2017efficient,
         
     | 
| 371 | 
         
            +
                title={Efficient Natural Language Response Suggestion for Smart Reply},
         
     | 
| 372 | 
         
            +
                author={Matthew Henderson and Rami Al-Rfou and Brian Strope and Yun-hsuan Sung and Laszlo Lukacs and Ruiqi Guo and Sanjiv Kumar and Balint Miklos and Ray Kurzweil},
         
     | 
| 373 | 
         
            +
                year={2017},
         
     | 
| 374 | 
         
            +
                eprint={1705.00652},
         
     | 
| 375 | 
         
            +
                archivePrefix={arXiv},
         
     | 
| 376 | 
         
            +
                primaryClass={cs.CL}
         
     | 
| 377 | 
         
            +
            }
         
     | 
| 378 | 
         
            +
            ```
         
     | 
| 379 | 
         
            +
             
     | 
| 380 | 
         
            +
            <!--
         
     | 
| 381 | 
         
            +
            ## Glossary
         
     | 
| 382 | 
         
            +
             
     | 
| 383 | 
         
            +
            *Clearly define terms in order to be accessible across audiences.*
         
     | 
| 384 | 
         
            +
            -->
         
     | 
| 385 | 
         
            +
             
     | 
| 386 | 
         
            +
            <!--
         
     | 
| 387 | 
         
            +
            ## Model Card Authors
         
     | 
| 388 | 
         
            +
             
     | 
| 389 | 
         
            +
            *Lists the people who create the model card, providing recognition and accountability for the detailed work that goes into its construction.*
         
     | 
| 390 | 
         
            +
            -->
         
     | 
| 391 | 
         
            +
             
     | 
| 392 | 
         
            +
            <!--
         
     | 
| 393 | 
         
            +
            ## Model Card Contact
         
     | 
| 394 | 
         
            +
             
     | 
| 395 | 
         
            +
            *Provides a way for people who have updates to the Model Card, suggestions, or questions, to contact the Model Card authors.*
         
     | 
| 396 | 
         
            +
            -->
         
     | 
    	
        config.json
    ADDED
    
    | 
         @@ -0,0 +1,25 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "architectures": [
         
     | 
| 3 | 
         
            +
                "BertModel"
         
     | 
| 4 | 
         
            +
              ],
         
     | 
| 5 | 
         
            +
              "attention_probs_dropout_prob": 0.1,
         
     | 
| 6 | 
         
            +
              "classifier_dropout": null,
         
     | 
| 7 | 
         
            +
              "gradient_checkpointing": false,
         
     | 
| 8 | 
         
            +
              "hidden_act": "gelu",
         
     | 
| 9 | 
         
            +
              "hidden_dropout_prob": 0.1,
         
     | 
| 10 | 
         
            +
              "hidden_size": 384,
         
     | 
| 11 | 
         
            +
              "initializer_range": 0.02,
         
     | 
| 12 | 
         
            +
              "intermediate_size": 1536,
         
     | 
| 13 | 
         
            +
              "layer_norm_eps": 1e-12,
         
     | 
| 14 | 
         
            +
              "max_position_embeddings": 512,
         
     | 
| 15 | 
         
            +
              "model_type": "bert",
         
     | 
| 16 | 
         
            +
              "num_attention_heads": 12,
         
     | 
| 17 | 
         
            +
              "num_hidden_layers": 6,
         
     | 
| 18 | 
         
            +
              "pad_token_id": 0,
         
     | 
| 19 | 
         
            +
              "position_embedding_type": "absolute",
         
     | 
| 20 | 
         
            +
              "torch_dtype": "float32",
         
     | 
| 21 | 
         
            +
              "transformers_version": "4.52.4",
         
     | 
| 22 | 
         
            +
              "type_vocab_size": 2,
         
     | 
| 23 | 
         
            +
              "use_cache": true,
         
     | 
| 24 | 
         
            +
              "vocab_size": 30522
         
     | 
| 25 | 
         
            +
            }
         
     | 
    	
        config_sentence_transformers.json
    ADDED
    
    | 
         @@ -0,0 +1,10 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "__version__": {
         
     | 
| 3 | 
         
            +
                "sentence_transformers": "4.1.0",
         
     | 
| 4 | 
         
            +
                "transformers": "4.52.4",
         
     | 
| 5 | 
         
            +
                "pytorch": "2.7.1"
         
     | 
| 6 | 
         
            +
              },
         
     | 
| 7 | 
         
            +
              "prompts": {},
         
     | 
| 8 | 
         
            +
              "default_prompt_name": null,
         
     | 
| 9 | 
         
            +
              "similarity_fn_name": "cosine"
         
     | 
| 10 | 
         
            +
            }
         
     | 
    	
        model.safetensors
    ADDED
    
    | 
         @@ -0,0 +1,3 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            version https://git-lfs.github.com/spec/v1
         
     | 
| 2 | 
         
            +
            oid sha256:ed75f08e8a83a2c17feca9a3abe70195524eed243f665523939aa37a9457e041
         
     | 
| 3 | 
         
            +
            size 90864192
         
     | 
    	
        modules.json
    ADDED
    
    | 
         @@ -0,0 +1,20 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            [
         
     | 
| 2 | 
         
            +
              {
         
     | 
| 3 | 
         
            +
                "idx": 0,
         
     | 
| 4 | 
         
            +
                "name": "0",
         
     | 
| 5 | 
         
            +
                "path": "",
         
     | 
| 6 | 
         
            +
                "type": "sentence_transformers.models.Transformer"
         
     | 
| 7 | 
         
            +
              },
         
     | 
| 8 | 
         
            +
              {
         
     | 
| 9 | 
         
            +
                "idx": 1,
         
     | 
| 10 | 
         
            +
                "name": "1",
         
     | 
| 11 | 
         
            +
                "path": "1_Pooling",
         
     | 
| 12 | 
         
            +
                "type": "sentence_transformers.models.Pooling"
         
     | 
| 13 | 
         
            +
              },
         
     | 
| 14 | 
         
            +
              {
         
     | 
| 15 | 
         
            +
                "idx": 2,
         
     | 
| 16 | 
         
            +
                "name": "2",
         
     | 
| 17 | 
         
            +
                "path": "2_Normalize",
         
     | 
| 18 | 
         
            +
                "type": "sentence_transformers.models.Normalize"
         
     | 
| 19 | 
         
            +
              }
         
     | 
| 20 | 
         
            +
            ]
         
     | 
    	
        runs/Jun16_15-17-17_snark.fritz.box/events.out.tfevents.1750079839.snark.fritz.box.61972.0
    ADDED
    
    | 
         @@ -0,0 +1,3 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            version https://git-lfs.github.com/spec/v1
         
     | 
| 2 | 
         
            +
            oid sha256:34f605c7b2c3d7a92e67ca8c4ced4cf7b6d6511df2b9d8103cb3d97a40869550
         
     | 
| 3 | 
         
            +
            size 6772
         
     | 
    	
        sentence_bert_config.json
    ADDED
    
    | 
         @@ -0,0 +1,4 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "max_seq_length": 256,
         
     | 
| 3 | 
         
            +
              "do_lower_case": false
         
     | 
| 4 | 
         
            +
            }
         
     | 
    	
        special_tokens_map.json
    ADDED
    
    | 
         @@ -0,0 +1,37 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "cls_token": {
         
     | 
| 3 | 
         
            +
                "content": "[CLS]",
         
     | 
| 4 | 
         
            +
                "lstrip": false,
         
     | 
| 5 | 
         
            +
                "normalized": false,
         
     | 
| 6 | 
         
            +
                "rstrip": false,
         
     | 
| 7 | 
         
            +
                "single_word": false
         
     | 
| 8 | 
         
            +
              },
         
     | 
| 9 | 
         
            +
              "mask_token": {
         
     | 
| 10 | 
         
            +
                "content": "[MASK]",
         
     | 
| 11 | 
         
            +
                "lstrip": false,
         
     | 
| 12 | 
         
            +
                "normalized": false,
         
     | 
| 13 | 
         
            +
                "rstrip": false,
         
     | 
| 14 | 
         
            +
                "single_word": false
         
     | 
| 15 | 
         
            +
              },
         
     | 
| 16 | 
         
            +
              "pad_token": {
         
     | 
| 17 | 
         
            +
                "content": "[PAD]",
         
     | 
| 18 | 
         
            +
                "lstrip": false,
         
     | 
| 19 | 
         
            +
                "normalized": false,
         
     | 
| 20 | 
         
            +
                "rstrip": false,
         
     | 
| 21 | 
         
            +
                "single_word": false
         
     | 
| 22 | 
         
            +
              },
         
     | 
| 23 | 
         
            +
              "sep_token": {
         
     | 
| 24 | 
         
            +
                "content": "[SEP]",
         
     | 
| 25 | 
         
            +
                "lstrip": false,
         
     | 
| 26 | 
         
            +
                "normalized": false,
         
     | 
| 27 | 
         
            +
                "rstrip": false,
         
     | 
| 28 | 
         
            +
                "single_word": false
         
     | 
| 29 | 
         
            +
              },
         
     | 
| 30 | 
         
            +
              "unk_token": {
         
     | 
| 31 | 
         
            +
                "content": "[UNK]",
         
     | 
| 32 | 
         
            +
                "lstrip": false,
         
     | 
| 33 | 
         
            +
                "normalized": false,
         
     | 
| 34 | 
         
            +
                "rstrip": false,
         
     | 
| 35 | 
         
            +
                "single_word": false
         
     | 
| 36 | 
         
            +
              }
         
     | 
| 37 | 
         
            +
            }
         
     | 
    	
        tokenizer.json
    ADDED
    
    | 
         The diff for this file is too large to render. 
		See raw diff 
     | 
| 
         | 
    	
        tokenizer_config.json
    ADDED
    
    | 
         @@ -0,0 +1,65 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            {
         
     | 
| 2 | 
         
            +
              "added_tokens_decoder": {
         
     | 
| 3 | 
         
            +
                "0": {
         
     | 
| 4 | 
         
            +
                  "content": "[PAD]",
         
     | 
| 5 | 
         
            +
                  "lstrip": false,
         
     | 
| 6 | 
         
            +
                  "normalized": false,
         
     | 
| 7 | 
         
            +
                  "rstrip": false,
         
     | 
| 8 | 
         
            +
                  "single_word": false,
         
     | 
| 9 | 
         
            +
                  "special": true
         
     | 
| 10 | 
         
            +
                },
         
     | 
| 11 | 
         
            +
                "100": {
         
     | 
| 12 | 
         
            +
                  "content": "[UNK]",
         
     | 
| 13 | 
         
            +
                  "lstrip": false,
         
     | 
| 14 | 
         
            +
                  "normalized": false,
         
     | 
| 15 | 
         
            +
                  "rstrip": false,
         
     | 
| 16 | 
         
            +
                  "single_word": false,
         
     | 
| 17 | 
         
            +
                  "special": true
         
     | 
| 18 | 
         
            +
                },
         
     | 
| 19 | 
         
            +
                "101": {
         
     | 
| 20 | 
         
            +
                  "content": "[CLS]",
         
     | 
| 21 | 
         
            +
                  "lstrip": false,
         
     | 
| 22 | 
         
            +
                  "normalized": false,
         
     | 
| 23 | 
         
            +
                  "rstrip": false,
         
     | 
| 24 | 
         
            +
                  "single_word": false,
         
     | 
| 25 | 
         
            +
                  "special": true
         
     | 
| 26 | 
         
            +
                },
         
     | 
| 27 | 
         
            +
                "102": {
         
     | 
| 28 | 
         
            +
                  "content": "[SEP]",
         
     | 
| 29 | 
         
            +
                  "lstrip": false,
         
     | 
| 30 | 
         
            +
                  "normalized": false,
         
     | 
| 31 | 
         
            +
                  "rstrip": false,
         
     | 
| 32 | 
         
            +
                  "single_word": false,
         
     | 
| 33 | 
         
            +
                  "special": true
         
     | 
| 34 | 
         
            +
                },
         
     | 
| 35 | 
         
            +
                "103": {
         
     | 
| 36 | 
         
            +
                  "content": "[MASK]",
         
     | 
| 37 | 
         
            +
                  "lstrip": false,
         
     | 
| 38 | 
         
            +
                  "normalized": false,
         
     | 
| 39 | 
         
            +
                  "rstrip": false,
         
     | 
| 40 | 
         
            +
                  "single_word": false,
         
     | 
| 41 | 
         
            +
                  "special": true
         
     | 
| 42 | 
         
            +
                }
         
     | 
| 43 | 
         
            +
              },
         
     | 
| 44 | 
         
            +
              "clean_up_tokenization_spaces": false,
         
     | 
| 45 | 
         
            +
              "cls_token": "[CLS]",
         
     | 
| 46 | 
         
            +
              "do_basic_tokenize": true,
         
     | 
| 47 | 
         
            +
              "do_lower_case": true,
         
     | 
| 48 | 
         
            +
              "extra_special_tokens": {},
         
     | 
| 49 | 
         
            +
              "mask_token": "[MASK]",
         
     | 
| 50 | 
         
            +
              "max_length": 128,
         
     | 
| 51 | 
         
            +
              "model_max_length": 256,
         
     | 
| 52 | 
         
            +
              "never_split": null,
         
     | 
| 53 | 
         
            +
              "pad_to_multiple_of": null,
         
     | 
| 54 | 
         
            +
              "pad_token": "[PAD]",
         
     | 
| 55 | 
         
            +
              "pad_token_type_id": 0,
         
     | 
| 56 | 
         
            +
              "padding_side": "right",
         
     | 
| 57 | 
         
            +
              "sep_token": "[SEP]",
         
     | 
| 58 | 
         
            +
              "stride": 0,
         
     | 
| 59 | 
         
            +
              "strip_accents": null,
         
     | 
| 60 | 
         
            +
              "tokenize_chinese_chars": true,
         
     | 
| 61 | 
         
            +
              "tokenizer_class": "BertTokenizer",
         
     | 
| 62 | 
         
            +
              "truncation_side": "right",
         
     | 
| 63 | 
         
            +
              "truncation_strategy": "longest_first",
         
     | 
| 64 | 
         
            +
              "unk_token": "[UNK]"
         
     | 
| 65 | 
         
            +
            }
         
     | 
    	
        training_args.bin
    ADDED
    
    | 
         @@ -0,0 +1,3 @@ 
     | 
|
| 
         | 
|
| 
         | 
|
| 
         | 
| 
         | 
|
| 1 | 
         
            +
            version https://git-lfs.github.com/spec/v1
         
     | 
| 2 | 
         
            +
            oid sha256:6b704fd35f9d2b6ae30dc7809d90d313db8787a073f0da45f0731caea409816e
         
     | 
| 3 | 
         
            +
            size 5969
         
     | 
    	
        vocab.txt
    ADDED
    
    | 
         The diff for this file is too large to render. 
		See raw diff 
     | 
| 
         |