End of training

1_Pooling/config.json

@@ -0,0 +1,10 @@
+{
+  "word_embedding_dimension": 384,
+  "pooling_mode_cls_token": false,
+  "pooling_mode_mean_tokens": true,
+  "pooling_mode_max_tokens": false,
+  "pooling_mode_mean_sqrt_len_tokens": false,
+  "pooling_mode_weightedmean_tokens": false,
+  "pooling_mode_lasttoken": false,
+  "include_prompt": true
+}

README.md

@@ -0,0 +1,396 @@
+---
+tags:
+- sentence-transformers
+- sentence-similarity
+- feature-extraction
+- generated_from_trainer
+- dataset_size:100
+- loss:MatryoshkaLoss
+- loss:MultipleNegativesRankingLoss
+base_model: sentence-transformers/all-MiniLM-L6-v2
+widget:
+- source_sentence: <start> TYTGGHJJUUYHTRRGGGRRDREDEERFED <end>
+  sentences:
+  - published
+  - published
+  - The
+- source_sentence: <start> GTYHYYHHHYYHGFFFTTTRRFERREEDDW <end>
+  sentences:
+  - B.
+  - The
+  - Spencers
+- source_sentence: The <start> LLMKIMYVERDWDERFTTTRFRRREEEERR <end> was later published
+    on Richard B.
+  sentences:
+  - The
+  - Spencers
+  - letter
+- source_sentence: The letter <start> WQWEWWWWDSAAWWSSAAZXZSSXXXDDSQ <end> later published
+    on Richard B.
+  sentences:
+  - The
+  - The
+  - was
+- source_sentence: The letter was <start> PLJUGRFVAAQAWQSFRFYTTRREEDDEGR <end> published
+    on Richard B.
+  sentences:
+  - later
+  - letter
+  - The
+pipeline_tag: sentence-similarity
+library_name: sentence-transformers
+---
+
+# SentenceTransformer based on sentence-transformers/all-MiniLM-L6-v2
+
+This is a [sentence-transformers](https://www.SBERT.net) model finetuned from [sentence-transformers/all-MiniLM-L6-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) on the generator dataset. It maps sentences & paragraphs to a 384-dimensional dense vector space and can be used for semantic textual similarity, semantic search, paraphrase mining, text classification, clustering, and more.
+
+## Model Details
+
+### Model Description
+- **Model Type:** Sentence Transformer
+- **Base model:** [sentence-transformers/all-MiniLM-L6-v2](https://huggingface.co/sentence-transformers/all-MiniLM-L6-v2) <!-- at revision c9745ed1d9f207416be6d2e6f8de32d1f16199bf -->
+- **Maximum Sequence Length:** 256 tokens
+- **Output Dimensionality:** 384 dimensions
+- **Similarity Function:** Cosine Similarity
+- **Training Dataset:**
+    - generator
+<!-- - **Language:** Unknown -->
+<!-- - **License:** Unknown -->
+
+### Model Sources
+
+- **Documentation:** [Sentence Transformers Documentation](https://sbert.net)
+- **Repository:** [Sentence Transformers on GitHub](https://github.com/UKPLab/sentence-transformers)
+- **Hugging Face:** [Sentence Transformers on Hugging Face](https://huggingface.co/models?library=sentence-transformers)
+
+### Full Model Architecture
+
+```
+SentenceTransformer(
+  (0): Transformer({'max_seq_length': 256, 'do_lower_case': False}) with Transformer model: BertModel 
+  (1): Pooling({'word_embedding_dimension': 384, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False, 'pooling_mode_weightedmean_tokens': False, 'pooling_mode_lasttoken': False, 'include_prompt': True})
+  (2): Normalize()
+)
+```
+
+## Usage
+
+### Direct Usage (Sentence Transformers)
+
+First install the Sentence Transformers library:
+
+```bash
+pip install -U sentence-transformers
+```
+
+Then you can load this model and run inference.
+```python
+from sentence_transformers import SentenceTransformer
+
+# Download from the 🤗 Hub
+model = SentenceTransformer("checkpoints")
+# Run inference
+sentences = [
+    'The letter was <start> PLJUGRFVAAQAWQSFRFYTTRREEDDEGR <end> published on Richard B.',
+    'later',
+    'The',
+]
+embeddings = model.encode(sentences)
+print(embeddings.shape)
+# [3, 384]
+
+# Get the similarity scores for the embeddings
+similarities = model.similarity(embeddings, embeddings)
+print(similarities.shape)
+# [3, 3]
+```
+
+<!--
+### Direct Usage (Transformers)
+
+<details><summary>Click to see the direct usage in Transformers</summary>
+
+</details>
+-->
+
+<!--
+### Downstream Usage (Sentence Transformers)
+
+You can finetune this model on your own dataset.
+
+<details><summary>Click to expand</summary>
+
+</details>
+-->
+
+<!--
+### Out-of-Scope Use
+
+*List how the model may foreseeably be misused and address what users ought not to do with the model.*
+-->
+
+<!--
+## Bias, Risks and Limitations
+
+*What are the known or foreseeable issues stemming from this model? You could also flag here known failure cases or weaknesses of the model.*
+-->
+
+<!--
+### Recommendations
+
+*What are recommendations with respect to the foreseeable issues? For example, filtering explicit content.*
+-->
+
+## Training Details
+
+### Training Dataset
+
+#### generator
+
+* Dataset: generator
+* Size: 100 training samples
+* Columns: <code>anchor</code> and <code>positive</code>
+* Approximate statistics based on the first 100 samples:
+  |         | anchor                                                                             | positive                                                                       |
+  |:--------|:-----------------------------------------------------------------------------------|:-------------------------------------------------------------------------------|
+  | type    | string                                                                             | string                                                                         |
+  | details | <ul><li>min: 23 tokens</li><li>mean: 30.92 tokens</li><li>max: 36 tokens</li></ul> | <ul><li>min: 3 tokens</li><li>mean: 3.2 tokens</li><li>max: 4 tokens</li></ul> |
+* Samples:
+  | anchor                                                    | positive         |
+  |:----------------------------------------------------------|:-----------------|
+  | <code><start> YGHGYYJHHHGRRERRERRDEERWWSWWER <end></code> | <code>The</code> |
+  | <code><start> GRHHHGYHBJYGGGDTRRRRRRFFEEEEDE <end></code> | <code>The</code> |
+  | <code><start> TTYHYJJMJJYHHYTRRFRRRRRTREEERW <end></code> | <code>The</code> |
+* Loss: [<code>MatryoshkaLoss</code>](https://sbert.net/docs/package_reference/sentence_transformer/losses.html#matryoshkaloss) with these parameters:
+  ```json
+  {
+      "loss": "MultipleNegativesRankingLoss",
+      "matryoshka_dims": [
+          384,
+          64
+      ],
+      "matryoshka_weights": [
+          1,
+          1
+      ],
+      "n_dims_per_step": -1
+  }
+  ```
+
+### Training Hyperparameters
+#### Non-Default Hyperparameters
+
+- `eval_strategy`: steps
+- `per_device_train_batch_size`: 4
+- `per_device_eval_batch_size`: 1
+- `learning_rate`: 2e-05
+- `weight_decay`: 0.01
+- `num_train_epochs`: 4
+- `lr_scheduler_type`: cosine
+- `warmup_ratio`: 0.1
+- `tf32`: False
+- `load_best_model_at_end`: True
+- `optim`: adamw_torch_fused
+
+#### All Hyperparameters
+<details><summary>Click to expand</summary>
+
+- `overwrite_output_dir`: False
+- `do_predict`: False
+- `eval_strategy`: steps
+- `prediction_loss_only`: True
+- `per_device_train_batch_size`: 4
+- `per_device_eval_batch_size`: 1
+- `per_gpu_train_batch_size`: None
+- `per_gpu_eval_batch_size`: None
+- `gradient_accumulation_steps`: 1
+- `eval_accumulation_steps`: None
+- `torch_empty_cache_steps`: None
+- `learning_rate`: 2e-05
+- `weight_decay`: 0.01
+- `adam_beta1`: 0.9
+- `adam_beta2`: 0.999
+- `adam_epsilon`: 1e-08
+- `max_grad_norm`: 1.0
+- `num_train_epochs`: 4
+- `max_steps`: -1
+- `lr_scheduler_type`: cosine
+- `lr_scheduler_kwargs`: {}
+- `warmup_ratio`: 0.1
+- `warmup_steps`: 0
+- `log_level`: passive
+- `log_level_replica`: warning
+- `log_on_each_node`: True
+- `logging_nan_inf_filter`: True
+- `save_safetensors`: True
+- `save_on_each_node`: False
+- `save_only_model`: False
+- `restore_callback_states_from_checkpoint`: False
+- `no_cuda`: False
+- `use_cpu`: False
+- `use_mps_device`: False
+- `seed`: 42
+- `data_seed`: None
+- `jit_mode_eval`: False
+- `use_ipex`: False
+- `bf16`: False
+- `fp16`: False
+- `fp16_opt_level`: O1
+- `half_precision_backend`: auto
+- `bf16_full_eval`: False
+- `fp16_full_eval`: False
+- `tf32`: False
+- `local_rank`: 0
+- `ddp_backend`: None
+- `tpu_num_cores`: None
+- `tpu_metrics_debug`: False
+- `debug`: []
+- `dataloader_drop_last`: False
+- `dataloader_num_workers`: 0
+- `dataloader_prefetch_factor`: None
+- `past_index`: -1
+- `disable_tqdm`: False
+- `remove_unused_columns`: True
+- `label_names`: None
+- `load_best_model_at_end`: True
+- `ignore_data_skip`: False
+- `fsdp`: []
+- `fsdp_min_num_params`: 0
+- `fsdp_config`: {'min_num_params': 0, 'xla': False, 'xla_fsdp_v2': False, 'xla_fsdp_grad_ckpt': False}
+- `fsdp_transformer_layer_cls_to_wrap`: None
+- `accelerator_config`: {'split_batches': False, 'dispatch_batches': None, 'even_batches': True, 'use_seedable_sampler': True, 'non_blocking': False, 'gradient_accumulation_kwargs': None}
+- `deepspeed`: None
+- `label_smoothing_factor`: 0.0
+- `optim`: adamw_torch_fused
+- `optim_args`: None
+- `adafactor`: False
+- `group_by_length`: False
+- `length_column_name`: length
+- `ddp_find_unused_parameters`: None
+- `ddp_bucket_cap_mb`: None
+- `ddp_broadcast_buffers`: False
+- `dataloader_pin_memory`: True
+- `dataloader_persistent_workers`: False
+- `skip_memory_metrics`: True
+- `use_legacy_prediction_loop`: False
+- `push_to_hub`: False
+- `resume_from_checkpoint`: None
+- `hub_model_id`: None
+- `hub_strategy`: every_save
+- `hub_private_repo`: None
+- `hub_always_push`: False
+- `gradient_checkpointing`: False
+- `gradient_checkpointing_kwargs`: None
+- `include_inputs_for_metrics`: False
+- `include_for_metrics`: []
+- `eval_do_concat_batches`: True
+- `fp16_backend`: auto
+- `push_to_hub_model_id`: None
+- `push_to_hub_organization`: None
+- `mp_parameters`: 
+- `auto_find_batch_size`: False
+- `full_determinism`: False
+- `torchdynamo`: None
+- `ray_scope`: last
+- `ddp_timeout`: 1800
+- `torch_compile`: False
+- `torch_compile_backend`: None
+- `torch_compile_mode`: None
+- `include_tokens_per_second`: False
+- `include_num_input_tokens_seen`: False
+- `neftune_noise_alpha`: None
+- `optim_target_modules`: None
+- `batch_eval_metrics`: False
+- `eval_on_start`: False
+- `use_liger_kernel`: False
+- `eval_use_gather_object`: False
+- `average_tokens_across_devices`: False
+- `prompts`: None
+- `batch_sampler`: batch_sampler
+- `multi_dataset_batch_sampler`: proportional
+
+</details>
+
+### Training Logs
+| Epoch | Step | Training Loss |
+|:-----:|:----:|:-------------:|
+| 0.4   | 10   | 5.9732        |
+| 0.8   | 20   | 5.0213        |
+| 1.2   | 30   | 2.5663        |
+| 1.6   | 40   | 2.3414        |
+| 2.0   | 50   | 1.6479        |
+| 2.4   | 60   | 1.4191        |
+| 2.8   | 70   | 1.4435        |
+| 3.2   | 80   | 1.5457        |
+| 3.6   | 90   | 1.3226        |
+| 4.0   | 100  | 1.1394        |
+
+
+### Framework Versions
+- Python: 3.11.13
+- Sentence Transformers: 4.1.0
+- Transformers: 4.52.4
+- PyTorch: 2.7.1
+- Accelerate: 1.7.0
+- Datasets: 3.6.0
+- Tokenizers: 0.21.1
+
+## Citation
+
+### BibTeX
+
+#### Sentence Transformers
+```bibtex
+@inproceedings{reimers-2019-sentence-bert,
+    title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks",
+    author = "Reimers, Nils and Gurevych, Iryna",
+    booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing",
+    month = "11",
+    year = "2019",
+    publisher = "Association for Computational Linguistics",
+    url = "https://arxiv.org/abs/1908.10084",
+}
+```
+
+#### MatryoshkaLoss
+```bibtex
+@misc{kusupati2024matryoshka,
+    title={Matryoshka Representation Learning},
+    author={Aditya Kusupati and Gantavya Bhatt and Aniket Rege and Matthew Wallingford and Aditya Sinha and Vivek Ramanujan and William Howard-Snyder and Kaifeng Chen and Sham Kakade and Prateek Jain and Ali Farhadi},
+    year={2024},
+    eprint={2205.13147},
+    archivePrefix={arXiv},
+    primaryClass={cs.LG}
+}
+```
+
+#### MultipleNegativesRankingLoss
+```bibtex
+@misc{henderson2017efficient,
+    title={Efficient Natural Language Response Suggestion for Smart Reply},
+    author={Matthew Henderson and Rami Al-Rfou and Brian Strope and Yun-hsuan Sung and Laszlo Lukacs and Ruiqi Guo and Sanjiv Kumar and Balint Miklos and Ray Kurzweil},
+    year={2017},
+    eprint={1705.00652},
+    archivePrefix={arXiv},
+    primaryClass={cs.CL}
+}
+```
+
+<!--
+## Glossary
+
+*Clearly define terms in order to be accessible across audiences.*
+-->
+
+<!--
+## Model Card Authors
+
+*Lists the people who create the model card, providing recognition and accountability for the detailed work that goes into its construction.*
+-->
+
+<!--
+## Model Card Contact
+
+*Provides a way for people who have updates to the Model Card, suggestions, or questions, to contact the Model Card authors.*
+-->

config.json

@@ -0,0 +1,25 @@
+{
+  "architectures": [
+    "BertModel"
+  ],
+  "attention_probs_dropout_prob": 0.1,
+  "classifier_dropout": null,
+  "gradient_checkpointing": false,
+  "hidden_act": "gelu",
+  "hidden_dropout_prob": 0.1,
+  "hidden_size": 384,
+  "initializer_range": 0.02,
+  "intermediate_size": 1536,
+  "layer_norm_eps": 1e-12,
+  "max_position_embeddings": 512,
+  "model_type": "bert",
+  "num_attention_heads": 12,
+  "num_hidden_layers": 6,
+  "pad_token_id": 0,
+  "position_embedding_type": "absolute",
+  "torch_dtype": "float32",
+  "transformers_version": "4.52.4",
+  "type_vocab_size": 2,
+  "use_cache": true,
+  "vocab_size": 30522
+}

config_sentence_transformers.json

@@ -0,0 +1,10 @@
+{
+  "__version__": {
+    "sentence_transformers": "4.1.0",
+    "transformers": "4.52.4",
+    "pytorch": "2.7.1"
+  },
+  "prompts": {},
+  "default_prompt_name": null,
+  "similarity_fn_name": "cosine"
+}

model.safetensors

@@ -0,0 +1,3 @@
+version https://git-lfs.github.com/spec/v1
+oid sha256:ed75f08e8a83a2c17feca9a3abe70195524eed243f665523939aa37a9457e041
+size 90864192

modules.json

@@ -0,0 +1,20 @@
+[
+  {
+    "idx": 0,
+    "name": "0",
+    "path": "",
+    "type": "sentence_transformers.models.Transformer"
+  },
+  {
+    "idx": 1,
+    "name": "1",
+    "path": "1_Pooling",
+    "type": "sentence_transformers.models.Pooling"
+  },
+  {
+    "idx": 2,
+    "name": "2",
+    "path": "2_Normalize",
+    "type": "sentence_transformers.models.Normalize"
+  }
+]

runs/Jun16_15-17-17_snark.fritz.box/events.out.tfevents.1750079839.snark.fritz.box.61972.0

@@ -0,0 +1,3 @@
+version https://git-lfs.github.com/spec/v1
+oid sha256:34f605c7b2c3d7a92e67ca8c4ced4cf7b6d6511df2b9d8103cb3d97a40869550
+size 6772

sentence_bert_config.json

@@ -0,0 +1,4 @@
+{
+  "max_seq_length": 256,
+  "do_lower_case": false
+}

special_tokens_map.json

@@ -0,0 +1,37 @@
+{
+  "cls_token": {
+    "content": "[CLS]",
+    "lstrip": false,
+    "normalized": false,
+    "rstrip": false,
+    "single_word": false
+  },
+  "mask_token": {
+    "content": "[MASK]",
+    "lstrip": false,
+    "normalized": false,
+    "rstrip": false,
+    "single_word": false
+  },
+  "pad_token": {
+    "content": "[PAD]",
+    "lstrip": false,
+    "normalized": false,
+    "rstrip": false,
+    "single_word": false
+  },
+  "sep_token": {
+    "content": "[SEP]",
+    "lstrip": false,
+    "normalized": false,
+    "rstrip": false,
+    "single_word": false
+  },
+  "unk_token": {
+    "content": "[UNK]",
+    "lstrip": false,
+    "normalized": false,
+    "rstrip": false,
+    "single_word": false
+  }
+}

tokenizer_config.json

@@ -0,0 +1,65 @@
+{
+  "added_tokens_decoder": {
+    "0": {
+      "content": "[PAD]",
+      "lstrip": false,
+      "normalized": false,
+      "rstrip": false,
+      "single_word": false,
+      "special": true
+    },
+    "100": {
+      "content": "[UNK]",
+      "lstrip": false,
+      "normalized": false,
+      "rstrip": false,
+      "single_word": false,
+      "special": true
+    },
+    "101": {
+      "content": "[CLS]",
+      "lstrip": false,
+      "normalized": false,
+      "rstrip": false,
+      "single_word": false,
+      "special": true
+    },
+    "102": {
+      "content": "[SEP]",
+      "lstrip": false,
+      "normalized": false,
+      "rstrip": false,
+      "single_word": false,
+      "special": true
+    },
+    "103": {
+      "content": "[MASK]",
+      "lstrip": false,
+      "normalized": false,
+      "rstrip": false,
+      "single_word": false,
+      "special": true
+    }
+  },
+  "clean_up_tokenization_spaces": false,
+  "cls_token": "[CLS]",
+  "do_basic_tokenize": true,
+  "do_lower_case": true,
+  "extra_special_tokens": {},
+  "mask_token": "[MASK]",
+  "max_length": 128,
+  "model_max_length": 256,
+  "never_split": null,
+  "pad_to_multiple_of": null,
+  "pad_token": "[PAD]",
+  "pad_token_type_id": 0,
+  "padding_side": "right",
+  "sep_token": "[SEP]",
+  "stride": 0,
+  "strip_accents": null,
+  "tokenize_chinese_chars": true,
+  "tokenizer_class": "BertTokenizer",
+  "truncation_side": "right",
+  "truncation_strategy": "longest_first",
+  "unk_token": "[UNK]"
+}

training_args.bin

@@ -0,0 +1,3 @@
+version https://git-lfs.github.com/spec/v1
+oid sha256:6b704fd35f9d2b6ae30dc7809d90d313db8787a073f0da45f0731caea409816e
+size 5969